Result : P9WP33
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Sulfur carrier protein CysO (9.5 kDa culture filtrate antigen cfp10A) |
| NCBI Accession ID | AJ007738.1 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1 |
| Right | 282 |
| Strand | + |
| Nucleotide Sequence | ATGAACGTCACCGTATCCATTCCGACCATCCTGCGGCCCCACACCGGCGGCCAGAAGAGTGTCTCGGCCAGCGGCGATACCTTGGGTGCCGTCATCAGCGACCTGGAGGCCAACTATTCGGGCATTTCCGAGCGCCTGATGGACCCGTCTTCCCCAGGTAAGTTGCACCGCTTCGTGAACATCTACGTCAACGACGAGGACGTGCGGTTCTCCGGCGGCTTGGCCACCGCGATCGCTGACGGTGACTCGGTCACCATCCTCCCCGCCGTGGCCGGTGGGTGA |
| Sequence | MNVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPSSPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG |
| Source of smORF | Swiss-Prot |
| Function | In its thiocarboxylated form (CysO-COSH), is the sulfur donor in the CysM-dependent cysteine biosynthetic pathway. May be of particular importance for cysteine biosynthesis in the persistent phase of M.tuberculosis. {ECO:0000269|Pubmed:16104727, ECO:0000269|Pubmed:18799456, ECO:0000269|Pubmed:18842002}. |
| Pubmed ID | 9634230 11681203 12123450 16104727 18842002 18799456 21969609 18771296 |
| Domain | CDD:421700 |
| Functional Category | Others |
| Uniprot ID | P9WP33 |
| ORF Length (Amino Acid) | 93 |
++ More..
| Conservation Analysis |
No. of Species: 247
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1503103 | 1503384 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1527802 | 1528083 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 614987 | 615268 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 1056313 | 1056585 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 5 | 4604911 | 4605192 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 6 | 3058616 | 3058900 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 7 | 4293466 | 4293747 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 8 | 5246683 | 5246955 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 9 | 2971294 | 2971566 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 10 | 3126508 | 3126804 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 11 | 3324710 | 3324991 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 12 | 2742364 | 2742645 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 13 | 4053218 | 4053490 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 14 | 2353575 | 2353871 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 15 | 42584 | 42856 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 16 | 4598573 | 4598845 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 17 | 3541734 | 3542006 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 18 | 5621325 | 5621606 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 19 | 2752890 | 2753171 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 20 | 1969961 | 1970233 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 21 | 6147170 | 6147442 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 22 | 1331072 | 1331353 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 23 | 4428427 | 4428699 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 24 | 5006807 | 5007088 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 25 | 2267080 | 2267352 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 26 | 385342 | 385623 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 27 | 782123 | 782404 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 28 | 2090047 | 2090319 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 29 | 110567 | 110851 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 30 | 5379666 | 5379959 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 31 | 3888924 | 3889205 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 32 | 2831378 | 2831686 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 33 | 3196184 | 3196459 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 34 | 458917 | 459198 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 35 | 4973129 | 4973401 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 36 | 1756548 | 1756820 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 37 | 1388235 | 1388507 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 38 | 5321164 | 5321448 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 39 | 4270354 | 4270626 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 40 | 167152 | 167424 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 41 | 398249 | 398521 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 42 | 5206104 | 5206376 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 43 | 3379740 | 3380009 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 44 | 1604058 | 1604330 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 45 | 1474577 | 1474849 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 46 | 1458566 | 1458838 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 47 | 2547474 | 2547746 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 48 | 5468424 | 5468717 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 49 | 1343522 | 1343794 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 50 | 1430999 | 1431271 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 51 | 659595 | 659867 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 52 | 1118483 | 1118755 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 53 | 1271300 | 1271572 | + | NZ_CP034550.1 | Saccharothrix syringae |
| 54 | 1227694 | 1227966 | + | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 55 | 5298827 | 5299105 | - | NZ_CP031142.1 | Saccharopolyspora pogona |
| 56 | 1330115 | 1330387 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 57 | 1229104 | 1229376 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 58 | 1327751 | 1328029 | + | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 59 | 1200727 | 1200999 | - | NZ_CP016793.1 | Lentzea guizhouensis |
| 60 | 4748488 | 4748766 | + | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 61 | 1326633 | 1326911 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 62 | 4128137 | 4128412 | - | NZ_CP059694.1 | Gordonia rubripertincta |
| 63 | 1108604 | 1108876 | + | NZ_CP023445.1 | Actinosynnema pretiosum |
| 64 | 2135962 | 2136234 | + | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 65 | 1123390 | 1123662 | + | NC_013093.1 | Actinosynnema mirum DSM 43827 |
| 66 | 1862796 | 1863101 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 67 | 5518683 | 5518961 | - | NZ_CP016353.1 | Prauserella marina |
| 68 | 3161917 | 3162195 | - | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 69 | 6560161 | 6560442 | - | NZ_AP023396.1 | Nocardia wallacei |
| 70 | 3998441 | 3998731 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 71 | 2073557 | 2073829 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 72 | 1418536 | 1418814 | + | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 73 | 2113710 | 2113994 | + | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 74 | 3814422 | 3814700 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
| 75 | 8510021 | 8510293 | - | NC_022116.1 | Amycolatopsis mediterranei RB |
| 76 | 1477605 | 1477877 | + | NZ_CP019066.1 | Tsukamurella tyrosinosolvens |
| 77 | 1292247 | 1292519 | + | NZ_CP008953.1 | Amycolatopsis japonica |
| 78 | 1655632 | 1655904 | + | NZ_CP016174.1 | Amycolatopsis orientalis |
| 79 | 1587735 | 1588010 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 80 | 1330660 | 1330938 | + | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 81 | 7292482 | 7292754 | - | NC_021252.1 | Amycolatopsis keratiniphila |
| 82 | 1470415 | 1470690 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 83 | 1381197 | 1381475 | + | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 84 | 1127361 | 1127639 | + | NZ_CP045929.1 | Saccharopolyspora coralli |
| 85 | 5530953 | 5531228 | - | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 86 | 2451553 | 2451855 | - | NZ_CP031194.1 | Streptomyces paludis |
| 87 | 4328719 | 4328994 | + | NZ_CP031194.1 | Streptomyces paludis |
| 88 | 4874487 | 4874765 | + | NC_016109.1 | Kitasatospora setae KM-6054 |
| 89 | 3167761 | 3168039 | - | NC_016109.1 | Kitasatospora setae KM-6054 |
| 90 | 1565469 | 1565762 | + | NZ_AP017900.1 | Nocardia seriolae |
| 91 | 7751238 | 7751516 | + | NZ_CP015163.1 | Amycolatopsis albispora |
| 92 | 3373386 | 3373661 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 93 | 2780947 | 2781225 | - | NZ_AP023439.1 | Streptomyces tuirus |
| 94 | 1006940 | 1007230 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 95 | 298833 | 299105 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 96 | 4347794 | 4348069 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 97 | 3676371 | 3676649 | - | NZ_CP023694.1 | Streptomyces coeruleorubidus |
| 98 | 3972595 | 3972882 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 99 | 4592415 | 4592690 | - | NZ_CP023690.1 | Streptomyces spectabilis |
| 100 | 3113326 | 3113613 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 101 | 3627976 | 3628251 | - | NZ_CP012382.1 | Streptomyces ambofaciens ATCC 23877 |
| 102 | 1207542 | 1207829 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 103 | 4738955 | 4739242 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 104 | 4228844 | 4229119 | + | NZ_CP023701.1 | Streptomyces subrutilus |
| 105 | 3582941 | 3583219 | - | NZ_CP022685.1 | Streptomyces formicae |
| 106 | 4369585 | 4369860 | - | NZ_CP022685.1 | Streptomyces formicae |
| 107 | 5648573 | 5648854 | - | NZ_AP023355.1 | Actinocatenispora thailandica |
| 108 | 3995066 | 3995341 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 109 | 3409407 | 3409685 | - | NZ_CP021978.1 | Streptomyces hawaiiensis |
| 110 | 5531850 | 5532137 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 111 | 4991191 | 4991466 | + | NZ_CP030073.1 | Streptomyces cadmiisoli |
| 112 | 1623778 | 1624053 | + | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 113 | 5247478 | 5247753 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 114 | 5856674 | 5856952 | + | NZ_CP032427.1 | Streptomyces griseorubiginosus |
| 115 | 3224523 | 3224798 | - | NZ_CP022310.1 | Streptomyces calvus |
| 116 | 4845107 | 4845385 | + | NZ_CP022310.1 | Streptomyces calvus |
| 117 | 4076839 | 4077114 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 118 | 3514969 | 3515247 | - | NZ_CP071839.1 | Streptomyces cyanogenus |
| 119 | 10292139 | 10292414 | - | NZ_CP016279.1 | Streptomyces griseochromogenes |
| 120 | 5900030 | 5900335 | + | NZ_CP023688.1 | Streptomyces rimosus |
| 121 | 3871122 | 3871400 | - | NZ_CP023688.1 | Streptomyces rimosus |
| 122 | 4128471 | 4128746 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 123 | 3485563 | 3485841 | - | NZ_CP015098.1 | Streptomyces qaidamensis |
| 124 | 77852 | 78151 | + | NZ_CP044344.1 | Nocardioides cynanchi |
| 125 | 3556512 | 3556790 | + | NZ_CP044344.1 | Nocardioides cynanchi |
| 126 | 2941288 | 2941575 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 127 | 3481074 | 3481349 | - | NZ_CP023407.1 | Streptomyces fungicidicus |
| 128 | 8759149 | 8759421 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 129 | 9420960 | 9421235 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 130 | 3652838 | 3653113 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 131 | 4323089 | 4323367 | + | NZ_CP022744.1 | Streptomyces lincolnensis |
| 132 | 3376949 | 3377224 | - | NZ_CP029043.1 | Streptomyces nigra |
| 133 | 2779854 | 2780132 | - | NZ_CP029043.1 | Streptomyces nigra |
| 134 | 2713845 | 2714132 | - | NZ_CP070242.1 | Streptomyces californicus |
| 135 | 3441920 | 3442198 | - | NZ_CP070242.1 | Streptomyces californicus |
| 136 | 2701922 | 2702209 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 137 | 3425422 | 3425700 | - | NZ_CP020570.1 | Streptomyces violaceoruber |
| 138 | 5468799 | 5469074 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 139 | 6049438 | 6049716 | + | NZ_CP017248.1 | Streptomyces fodineus |
| 140 | 2906378 | 2906656 | - | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 141 | 4643676 | 4643954 | + | NZ_CP072931.1 | Streptomyces auratus AGR0001 |
| 142 | 2797406 | 2797681 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 143 | 2282920 | 2283198 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 144 | 3358753 | 3359028 | + | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 145 | 2595856 | 2596143 | - | NZ_CP042266.1 | Streptomyces qinzhouensis |
| 146 | 4083989 | 4084267 | - | NZ_CP070326.1 | Streptomyces noursei |
| 147 | 5738126 | 5738404 | + | NZ_CP070326.1 | Streptomyces noursei |
| 148 | 365349 | 365609 | - | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 149 | 1582685 | 1582960 | + | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 150 | 738816 | 739091 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 151 | 1405504 | 1405782 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 152 | 5073936 | 5074208 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 153 | 3376096 | 3376374 | - | NZ_CP023691.1 | Streptomyces platensis |
| 154 | 5209325 | 5209603 | + | NZ_CP023691.1 | Streptomyces platensis |
| 155 | 4565397 | 4565672 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 156 | 3717313 | 3717591 | - | NZ_CP045096.1 | Streptomyces phaeolivaceus |
| 157 | 7205169 | 7205450 | - | NC_014666.1 | Frankia inefficax |
| 158 | 5656378 | 5656653 | - | NZ_CP018082.1 | Nocardia mangyaensis |
| 159 | 653707 | 653979 | + | NZ_CP049257.1 | Nocardioides anomalus |
| 160 | 3439629 | 3439907 | - | NZ_CP059991.1 | Streptomyces gardneri |
| 161 | 4924838 | 4925113 | + | NZ_CP059991.1 | Streptomyces gardneri |
| 162 | 3692583 | 3692858 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 163 | 3143734 | 3144012 | - | NZ_CP063374.1 | Streptomyces chromofuscus |
| 164 | 5810417 | 5810716 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 165 | 5091852 | 5092127 | + | NZ_CP060404.1 | Streptomyces buecherae |
| 166 | 4770449 | 4770724 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 167 | 5396916 | 5397194 | + | NZ_CP011340.1 | Streptomyces pristinaespiralis |
| 168 | 2710711 | 2710998 | - | NZ_CP020700.1 | Streptomyces tsukubensis |
| 169 | 3439427 | 3439702 | + | NZ_CP020700.1 | Streptomyces tsukubensis |
| 170 | 3298721 | 3298999 | - | NZ_CP019457.1 | Streptomyces lydicus |
| 171 | 5086986 | 5087261 | + | NZ_CP019457.1 | Streptomyces lydicus |
| 172 | 4662075 | 4662353 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 173 | 4126593 | 4126871 | + | NZ_CP023692.1 | Streptomyces vinaceus |
| 174 | 4607337 | 4607612 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 175 | 5124509 | 5124787 | + | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 176 | 916499 | 916786 | + | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 177 | 589497 | 589775 | + | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 178 | 5295107 | 5295385 | - | NZ_CP065050.1 | Streptomyces solisilvae |
| 179 | 486947 | 487219 | + | NZ_CP033972.1 | Gordonia insulae |
| 180 | 4541692 | 4542021 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 181 | 3998089 | 3998364 | + | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 182 | 4969783 | 4970058 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 183 | 4322435 | 4322713 | - | NZ_CP034463.1 | Streptomyces aquilus |
| 184 | 6316144 | 6316422 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 185 | 5541213 | 5541488 | + | NZ_CP023699.1 | Streptomyces kanamyceticus |
| 186 | 3271963 | 3272238 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 187 | 2722398 | 2722676 | - | NZ_CP015866.1 | Streptomyces parvulus |
| 188 | 2755688 | 2755975 | - | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 189 | 4378900 | 4379175 | + | NZ_CP040752.1 | Streptomyces rectiverticillatus |
| 190 | 2307691 | 2307969 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 191 | 2937336 | 2937614 | - | NZ_CP031264.1 | Streptacidiphilus bronchialis |
| 192 | 1061232 | 1061510 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 193 | 3858414 | 3858692 | - | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 194 | 794687 | 794968 | - | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 195 | 3565750 | 3566043 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 196 | 4389075 | 4389350 | - | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 197 | 5943216 | 5943494 | + | NZ_AP023440.1 | Streptomyces glomeroaurantiacus |
| 198 | 5152081 | 5152356 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 199 | 5737929 | 5738207 | + | NZ_CP045643.1 | Streptomyces fagopyri |
| 200 | 3738170 | 3738448 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 201 | 4322104 | 4322382 | - | NZ_CP071139.1 | Streptomyces nojiriensis |
| 202 | 5617535 | 5617810 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 203 | 6299977 | 6300255 | + | NC_013929.1 | Streptomyces scabiei 87.22 |
| 204 | 3984465 | 3984740 | - | NZ_CP032698.1 | Streptomyces hundungensis |
| 205 | 5359996 | 5360274 | + | NZ_CP032698.1 | Streptomyces hundungensis |
| 206 | 1666131 | 1666409 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 207 | 4354733 | 4355011 | - | NZ_CP009896.1 | Pimelobacter simplex |
| 208 | 3556851 | 3557135 | + | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 209 | 3156122 | 3156397 | + | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 210 | 3594175 | 3594450 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 211 | 2965829 | 2966107 | - | NZ_CP023695.1 | Streptomyces alboniger |
| 212 | 6128270 | 6128548 | - | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 213 | 8027202 | 8027480 | + | NC_016582.1 | Streptomyces bingchenggensis BCW-1 |
| 214 | 3370789 | 3371067 | - | NZ_CP023698.1 | Streptomyces viridifaciens |
| 215 | 4812990 | 4813268 | + | NZ_CP023698.1 | Streptomyces viridifaciens |
| 216 | 6099791 | 6100069 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 217 | 5365149 | 5365424 | + | NZ_CP023689.1 | Streptomyces chartreusis |
| 218 | 3047718 | 3047996 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 219 | 3628112 | 3628387 | - | NZ_CP023703.1 | Streptomyces galilaeus |
| 220 | 2411040 | 2411327 | + | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 221 | 537581 | 537856 | - | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 222 | 3902358 | 3902636 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 223 | 4605539 | 4605814 | - | NZ_CP034539.1 | Streptomyces cyaneochromogenes |
| 224 | 6508162 | 6508440 | - | NZ_CP030862.1 | Streptomyces globosus |
| 225 | 5984874 | 5985152 | - | NZ_CP030862.1 | Streptomyces globosus |
| 226 | 3924280 | 3924558 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 227 | 4535367 | 4535642 | - | NZ_CP047020.1 | Streptomyces broussonetiae |
| 228 | 4040818 | 4041093 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 229 | 3509120 | 3509398 | - | NC_021985.1 | Streptomyces collinus Tu 365 |
| 230 | 427218 | 427490 | - | NZ_CP038436.1 | Nocardioides seonyuensis |
| 231 | 909529 | 909804 | - | NZ_CP038436.1 | Nocardioides seonyuensis |
| 232 | 1604742 | 1605062 | + | NC_008278.1 | Frankia alni ACN14a |
| 233 | 3859584 | 3859856 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 234 | 1011182 | 1011469 | + | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 235 | 649520 | 649798 | + | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 236 | 4626547 | 4626825 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 237 | 3995238 | 3995516 | + | NZ_CP034279.1 | Streptomyces ficellus |
| 238 | 3662365 | 3662643 | - | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 239 | 5464514 | 5464798 | + | NZ_CP020569.1 | Streptomyces gilvosporeus |
| 240 | 2586669 | 2586947 | - | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 241 | 2049073 | 2049369 | - | NC_016111.1 | Streptomyces cattleya NRRL 8057 = DSM 46488 |
| 242 | 2787742 | 2788020 | - | NC_020990.1 | Streptomyces albidoflavus |
| 243 | 2105022 | 2105306 | - | NC_020990.1 | Streptomyces albidoflavus |
| 244 | 4355633 | 4355908 | + | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 245 | 3072383 | 3072661 | - | NZ_CP010849.1 | Streptomyces cyaneogriseus subsp. noncyanogenus |
| 246 | 4780073 | 4780348 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 247 | 5417232 | 5417510 | + | NZ_CP026652.1 | Streptomyces dengpaensis |
| 248 | 2159321 | 2159608 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 249 | 3127410 | 3127685 | - | NZ_CP029188.1 | Streptomyces tirandamycinicus |
| 250 | 5004484 | 5004762 | + | NZ_CP027306.1 | Streptomyces atratus |
| 251 | 2830631 | 2830918 | - | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 252 | 4563985 | 4564263 | + | NC_021177.1 | Streptomyces fulvissimus DSM 40593 |
| 253 | 3069164 | 3069439 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 254 | 4484056 | 4484337 | + | NZ_CP065253.1 | Streptomyces clavuligerus |
| 255 | 6270890 | 6271177 | + | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 256 | 4856813 | 4857088 | - | NC_003155.5 | Streptomyces avermitilis MA-4680 = NBRC 14893 |
| 257 | 3607103 | 3607381 | + | NZ_CP054938.1 | Streptomyces harbinensis |
| 258 | 4269330 | 4269611 | + | NZ_CP054938.1 | Streptomyces harbinensis |
| 259 | 3232397 | 3232675 | - | NZ_CP031742.1 | Streptomyces koyangensis |
| 260 | 2531179 | 2531463 | - | NZ_CP031742.1 | Streptomyces koyangensis |
| 261 | 4403683 | 4403958 | + | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 262 | 2805134 | 2805415 | - | NZ_CP072827.1 | Streptomyces mobaraensis NBRC 13819 = DSM 40847 |
| 263 | 1835348 | 1835635 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 264 | 3181885 | 3182160 | - | NZ_CP029254.1 | Streptomyces spongiicola |
| 265 | 2122989 | 2123267 | + | NZ_LR134352.1 | Nocardia asteroides |
| 266 | 1839196 | 1839468 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 267 | 10446830 | 10447105 | - | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 268 | 4705742 | 4706020 | + | NZ_CP051006.1 | Streptomyces griseofuscus |
| 269 | 4788045 | 4788320 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 270 | 5389925 | 5390203 | + | NZ_CP034687.1 | Streptomyces griseoviridis |
| 271 | 1843136 | 1843414 | + | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 272 | 9844474 | 9844749 | - | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 273 | 5096402 | 5096710 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 274 | 4401124 | 4401402 | + | NZ_CP048882.1 | Streptomyces bathyalis |
| 275 | 2751233 | 2751508 | - | NZ_CP012371.1 | Nitrosospira briensis C-128 |
| 276 | 4672908 | 4673186 | + | NZ_CP010407.1 | Streptomyces vietnamensis |
| 277 | 3221465 | 3221743 | - | NZ_CP010407.1 | Streptomyces vietnamensis |
| 278 | 7249571 | 7249849 | - | NZ_CP051486.1 | Streptomyces pratensis |
| 279 | 437408 | 437683 | + | NZ_CP051486.1 | Streptomyces pratensis |
| 280 | 1717528 | 1717848 | - | NZ_CP016022.1 | Ralstonia insidiosa |
| 281 | 4127060 | 4127341 | - | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 282 | 5739876 | 5740151 | + | NZ_CP031455.1 | Streptomyces olivoreticuli subsp. olivoreticuli |
| 283 | 2944721 | 2945011 | - | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 284 | 5184084 | 5184362 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 285 | 1037645 | 1037923 | + | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 286 | 2256805 | 2257083 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 287 | 2879306 | 2879581 | - | NZ_CP017316.1 | Streptomyces rubrolavendulae |
| 288 | 2400885 | 2401163 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 289 | 3021134 | 3021409 | - | NZ_CP023696.1 | Streptomyces fradiae ATCC 10745 = DSM 40063 |
| 290 | 1148977 | 1149255 | - | NZ_CP041146.1 | Nocardioides humi |
| 291 | 4727119 | 4727397 | + | NZ_CP041146.1 | Nocardioides humi |
| 292 | 5369094 | 5369372 | + | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 293 | 3381504 | 3381782 | - | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 294 | 4252687 | 4252965 | + | NZ_CP029196.1 | Streptomyces venezuelae |
| 295 | 2758163 | 2758441 | - | NZ_CP029196.1 | Streptomyces venezuelae |
| 296 | 2873259 | 2873537 | - | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 297 | 4469612 | 4469890 | + | NZ_CP013738.1 | Streptomyces globisporus C-1027 |
| 298 | 4165298 | 4165579 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 299 | 3423520 | 3423798 | + | NZ_CP009922.3 | Streptomyces xiamenensis |
| 300 | 4028422 | 4028697 | + | NZ_CP021080.1 | Streptomyces pluripotens |
| 301 | 2528344 | 2528622 | - | NZ_CP021080.1 | Streptomyces pluripotens |
| 302 | 1008100 | 1008417 | + | NC_017093.1 | Actinoplanes missouriensis 431 |
| 303 | 891871 | 892149 | + | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 304 | 4418413 | 4418706 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 305 | 5440442 | 5440720 | + | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 306 | 3748596 | 3748874 | - | NC_010572.1 | Streptomyces griseus subsp. griseus NBRC 13350 |
| 307 | 1038053 | 1038367 | + | NZ_CP023865.1 | Actinoplanes teichomyceticus ATCC 31121 |
| 308 | 4492689 | 4492967 | + | NZ_CP020563.1 | Kitasatospora albolonga |
| 309 | 2612786 | 2613064 | - | NZ_CP020563.1 | Kitasatospora albolonga |
| 310 | 4224638 | 4224916 | + | NZ_CP024957.1 | Streptomyces cavourensis |
| 311 | 2529249 | 2529527 | - | NZ_CP024957.1 | Streptomyces cavourensis |
| 312 | 3613859 | 3614131 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 313 | 2358592 | 2358864 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 314 | 2626128 | 2626406 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 315 | 1286462 | 1286740 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 316 | 1543484 | 1543774 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 317 | 4894891 | 4895169 | + | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 318 | 3354792 | 3355067 | - | NZ_CP023702.1 | Streptomyces nitrosporeus |
| 319 | 2928396 | 2928674 | - | NZ_CP023693.1 | Streptomyces cinereoruber |
| 320 | 4298080 | 4298358 | + | NZ_CP023693.1 | Streptomyces cinereoruber |
| 321 | 2080581 | 2080859 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 322 | 3281323 | 3281595 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 323 | 3433422 | 3433700 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 324 | 3991590 | 3991865 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 325 | 401921 | 402199 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 326 | 4190177 | 4190452 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 327 | 4997842 | 4998117 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 328 | 1128565 | 1128837 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 329 | 2943780 | 2944073 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 330 | 554423 | 554737 | + | NZ_CP068286.1 | Ralstonia syzygii subsp. celebesensis |
| 331 | 2554940 | 2555212 | - | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 332 | 1940169 | 1940447 | + | NC_013729.1 | Kribbella flavida DSM 17836 |
| 333 | 1290957 | 1291232 | + | NC_013729.1 | Kribbella flavida DSM 17836 |
| 334 | 897724 | 898038 | + | NZ_CP012944.1 | Ralstonia solanacearum |
| 335 | 474965 | 475243 | + | NZ_CP011502.1 | Aeromicrobium erythreum |
| 336 | 5479798 | 5480076 | + | NZ_CP043661.1 | Kribbella qitaiheensis |
| 337 | 6114002 | 6114280 | + | NZ_CP043661.1 | Kribbella qitaiheensis |
| 338 | 76604 | 76885 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 339 | 1616956 | 1617252 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 340 | 1965662 | 1965907 | + | NZ_CP013106.1 | Halomonas huangheensis |
| 341 | 1899745 | 1900017 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 342 | 830350 | 830640 | + | NZ_CP011451.1 | Nitrosomonas communis |
| 343 | 3247979 | 3248254 | - | NZ_CP045851.1 | Actinomarinicola tropica |
| 344 | 9532248 | 9532520 | - | NZ_CP012333.1 | Labilithrix luteola |
| 345 | 215507 | 215782 | - | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 346 | 1281570 | 1281860 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 347 | 8399286 | 8399531 | + | NC_019892.1 | Singulisphaera acidiphila DSM 18658 |
| 348 | 3324805 | 3325074 | + | NZ_CP042997.1 | Aquisphaera giovannonii |
| 349 | 543992 | 544267 | + | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 350 | 887874 | 888149 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 351 | 196047 | 196331 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 352 | 4556194 | 4556466 | - | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 353 | 1772753 | 1773022 | - | NZ_CP019082.1 | Paludisphaera borealis |
| 354 | 8089857 | 8090135 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 355 | 2213007 | 2213282 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 356 | 3343379 | 3343654 | + | NZ_CP042430.1 | Baekduia soli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02617.19 | 0.7 | 173 | 2243 | same-strand | ATP-dependent Clp protease adaptor protein ClpS |
| 2 | PF09438.12 | 0.7 | 173 | 1680 | same-strand | Domain of unknown function (DUF2017) |
| 3 | PF14464.8 | 0.9 | 223 | 79.5 | same-strand | Prokaryotic homologs of the JAB domain |
| 4 | PF00291.27 | 0.92 | 228 | 10.0 | same-strand | Pyridoxal-phosphate dependent enzyme |
| 5 | PF12706.9 | 0.72 | 179 | 2081 | same-strand | Beta-lactamase superfamily domain |
++ More..