Result : P9WNI8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESAT-6-like protein EsxR |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 3374447 |
| Right | 3374737 |
| Strand | - |
| Nucleotide Sequence | ATGTCGCAGATTATGTACAACTATCCGGCGATGATGGCTCATGCCGGGGACATGGCCGGTTATGCGGGCACGCTGCAGAGCTTGGGGGCCGATATCGCCAGTGAGCAGGCCGTGCTGTCCAGTGCTTGGCAGGGTGATACCGGGATCACGTATCAGGGCTGGCAGACCCAGTGGAACCAGGCCCTAGAGGATCTGGTGCGGGCCTATCAGTCGATGTCTGGCACCCATGAGTCCAACACCATGGCGATGTTGGCTCGAGATGGGGCCGAAGCCGCCAAGTGGGGCGGCTAG |
| Sequence | MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQALEDLVRAYQSMSGTHESNTMAMLARDGAEAAKWGG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313; |
| Pubmed ID | 12218036 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | P9WNI8 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 78
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3378711 | 3379001 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 351848 | 352138 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 3441421 | 3441711 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 362348 | 362638 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 3166271 | 3166558 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 6 | 4134041 | 4134328 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 7 | 4809734 | 4810021 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 8 | 2078690 | 2078980 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 9 | 4998229 | 4998519 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 10 | 721159 | 721449 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 11 | 3349344 | 3349634 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 12 | 4316855 | 4317145 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 13 | 1868498 | 1868788 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 14 | 3714372 | 3714662 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 15 | 1580290 | 1580580 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 16 | 3724999 | 3725289 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 17 | 4520095 | 4520385 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 18 | 3229830 | 3230120 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 19 | 3008199 | 3008486 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 20 | 815431 | 815721 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 21 | 3490391 | 3490681 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 22 | 724328 | 724618 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 23 | 490959 | 491249 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 24 | 4837877 | 4838167 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 25 | 679136 | 679426 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 26 | 1637347 | 1637637 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 27 | 4109757 | 4110047 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 28 | 3739329 | 3739619 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 29 | 3764553 | 3764843 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 30 | 4794756 | 4795046 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 31 | 4538345 | 4538635 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 32 | 436307 | 436597 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 33 | 4998080 | 4998370 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 34 | 5101253 | 5101543 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 35 | 3911411 | 3911701 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 36 | 114403 | 114693 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 37 | 4724108 | 4724398 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 38 | 4417710 | 4418000 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 39 | 1850897 | 1851187 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 40 | 1117079 | 1117369 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 41 | 292608 | 292898 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 42 | 4522975 | 4523265 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 43 | 2205858 | 2206148 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 44 | 2108734 | 2109024 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 45 | 3451898 | 3452188 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 46 | 3140736 | 3141026 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 47 | 512568 | 512858 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 48 | 2501824 | 2502114 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 49 | 4520801 | 4521088 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 50 | 517141 | 517431 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 51 | 3885984 | 3886274 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 52 | 1652094 | 1652381 | - | NZ_AP022562.1 | Mycobacterium novum |
| 53 | 1641008 | 1641295 | - | NZ_AP022562.1 | Mycobacterium novum |
| 54 | 305550 | 305837 | + | NC_015576.1 | Mycolicibacter sinensis |
| 55 | 316635 | 316922 | + | NC_015576.1 | Mycolicibacter sinensis |
| 56 | 4914422 | 4914712 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 57 | 1900781 | 1901068 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 58 | 4077372 | 4077659 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 59 | 4498506 | 4498793 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 60 | 3598337 | 3598624 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 61 | 1958450 | 1958737 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 62 | 297300 | 297587 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 63 | 286225 | 286512 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 64 | 369081 | 369371 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 65 | 18086 | 18376 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 66 | 4717967 | 4718257 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 67 | 2145678 | 2145965 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 68 | 89136 | 89423 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 69 | 6825104 | 6825391 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 70 | 1504377 | 1504664 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 71 | 5375242 | 5375529 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 72 | 1861509 | 1861796 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 73 | 3211246 | 3211533 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 74 | 567186 | 567473 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 75 | 350468 | 350761 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 76 | 1934011 | 1934301 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 77 | 4483905 | 4484192 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 78 | 997070 | 997357 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 79 | 4056188 | 4056475 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 80 | 4067233 | 4067520 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 81 | 1966250 | 1966537 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 82 | 738215 | 738502 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 83 | 1015701 | 1015988 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 84 | 507294 | 507581 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 85 | 394735 | 395022 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 86 | 4136744 | 4137031 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 87 | 455451 | 455738 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 88 | 3093368 | 3093661 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 89 | 957218 | 957505 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 90 | 385560 | 385847 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 91 | 3904935 | 3905222 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 92 | 1767703 | 1767996 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 93 | 1770294 | 1770587 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 94 | 2508574 | 2508861 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 95 | 2938275 | 2938565 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 96 | 3378235 | 3378522 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 97 | 956019 | 956306 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 98 | 406782 | 407069 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 99 | 4856267 | 4856557 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 100 | 3938936 | 3939223 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 101 | 735340 | 735627 | + | NC_014168.1 | Segniliparus rotundus DSM 44985 |
| 102 | 46093 | 46383 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 103 | 2258536 | 2258826 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 104 | 104256 | 104546 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 105 | 784970 | 785260 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 106 | 2388149 | 2388439 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 107 | 41893 | 42183 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 108 | 573621 | 573911 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 109 | 1969817 | 1970107 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 110 | 578652 | 578942 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 111 | 51913 | 52203 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 112 | 1957372 | 1957662 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 113 | 51232 | 51522 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 114 | 615932 | 616222 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 115 | 2150480 | 2150770 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 116 | 2220938 | 2221228 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 117 | 47718 | 48008 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 118 | 624098 | 624388 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06013.14 | 0.82 | 64 | 31.0 | same-strand | Proteins of 100 residues with WXG |
| 2 | PF00823.21 | 0.95 | 74 | 379.0 | same-strand | PPE family |
| 3 | PF18878.2 | 0.94 | 73 | 378 | same-strand | PPE-PPW subfamily C-terminal region |
| 4 | PF00934.22 | 1.0 | 78 | 1908.0 | same-strand | PE family |
| 5 | PF05108.15 | 0.97 | 76 | 6206.5 | same-strand | Type VII secretion system ESX-1, transport TM domain B |
| 6 | PF01580.20 | 1.0 | 78 | 2230.0 | same-strand | FtsK/SpoIIIE family |
| 7 | PF14011.8 | 1.0 | 78 | 11.0 | same-strand | EspG family |
| 8 | PF08817.12 | 1.0 | 78 | 943 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
| 9 | PF00082.24 | 1.0 | 78 | 2357 | same-strand | Subtilase family |
| 10 | PF11203.10 | 0.85 | 66 | 3752 | same-strand | Putative type VII ESX secretion system translocon, EccE |
++ More..