Result : P9WNH8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESAT-6-like protein EsxE |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 4382744 |
| Right | 4383016 |
| Strand | - |
| Nucleotide Sequence | GTGGATCCGACCGTGTTGGCTGATGCGGTGGCGCGGATGGCCGAATTCGGTCGCCACGTCGAGGAGCTGGTCGCCGAGATTGAGTCCTTGGTTACCCGGCTGCATGTGACGTGGACGGGGGAGGGCGCGGCGGCTCATGCTGAGGCGCAACGACATTGGGCTGCCGGTGAGGCGATGATGCGCCAGGCGTTGGCCCAGCTCACGGCCGCGGGGCAGAGCGCGCACGCCAACTACACCGGCGCGATGGCCACGAATTTGGGTATGTGGTCGTGA |
| Sequence | MDPTVLADAVARMAEFGRHVEELVAEIESLVTRLHVTWTGEGAAAHAEAQRHWAAGEAMMRQALAQLTAAGQSAHANYTGAMATNLGMWS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12218036 17088352 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WNH8 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4390437 | 4390709 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 4460959 | 4461231 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3213528 | 3213800 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 4 | 3849588 | 3849860 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 5 | 4779423 | 4779659 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 6 | 618434 | 618706 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 7 | 6036956 | 6037228 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 8 | 1450237 | 1450509 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 9 | 4573406 | 4573678 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 10 | 4455875 | 4456111 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 11 | 4871867 | 4872103 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 12 | 4982210 | 4982482 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 13 | 3732613 | 3732885 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 14 | 748695 | 748931 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 15 | 3677125 | 3677397 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 16 | 4743431 | 4743667 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 17 | 4610064 | 4610336 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 18 | 3001609 | 3001866 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 19 | 3188927 | 3189199 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 20 | 3507623 | 3507859 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 21 | 2882413 | 2882685 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 22 | 1865309 | 1865581 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 23 | 4234149 | 4234373 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 24 | 1366467 | 1366739 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 25 | 1378000 | 1378272 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 26 | 4572426 | 4572698 | + | NZ_AP022581.1 | Mycobacterium lacus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06013.14 | 0.96 | 25 | 11.0 | same-strand | Proteins of 100 residues with WXG |
++ More..