ProsmORF-pred
Result : P9WN16
Protein Information
Information Type Description
Protein name Putative glutaredoxin MT3292 (EC 1.-.-.-)
NCBI Accession ID AE000516.2
Organism Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Left 3566240
Right 3566494
Strand +
Nucleotide Sequence ATGATCACCGCTGCGCTCACCATCTATACGACATCATGGTGTGGCTATTGCCTTCGACTCAAAACAGCGCTCACGGCCAACCGAATCGCTTACGACGAGGTCGACATCGAACACAACCGTGCGGCCGCGGAGTTCGTCGGCTCGGTCAATGGCGGCAACAGAACTGTTCCCACGGTGAAGTTCGCCGACGGGTCGACGCTGACTAACCCGAGCGCGGACGAGGTCAAAGCGAAGCTGGTAAAGATCGCGGGTTAA
Sequence MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAG
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond.
Pubmed ID 12218036
Domain CDD:412351
Functional Category Others
Uniprot ID P9WN16
ORF Length (Amino Acid) 84
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 246
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3571335 3571589 + NC_000962.3 Mycobacterium tuberculosis H37Rv
2 3626010 3626264 + NC_015848.1 Mycobacterium canettii CIPT 140010059
3 523318 523572 - NZ_AP022581.1 Mycobacterium lacus
4 1107888 1108142 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
5 3074916 3075170 - NZ_CP058277.1 Mycobacterium marinum
6 5734287 5734541 + NZ_AP022572.1 Mycobacterium shottsii
7 2648218 2648472 + NZ_AP022575.1 Mycobacterium shinjukuense
8 5359300 5359554 - NZ_AP022619.1 Mycobacterium paraseoulense
9 1638492 1638737 - NZ_CP025546.1 Mycobacterium paragordonae
10 43883 44137 - NZ_AP022582.1 Mycobacterium seoulense
11 863890 864144 + NZ_AP022615.1 Mycobacterium heidelbergense
12 1306003 1306257 + NZ_AP022568.1 Mycobacterium simiae
13 4755136 4755390 - NC_022663.1 Mycobacterium kansasii ATCC 12478
14 3052099 3052362 - NZ_AP022583.1 Mycobacterium noviomagense
15 2225671 2225925 + NZ_AP022576.1 Mycobacterium florentinum
16 1026092 1026346 - NZ_AP022613.1 Mycobacterium conspicuum
17 226951 227193 + NZ_AP022606.1 Mycobacterium branderi
18 2529231 2529485 + NZ_AP022587.1 Mycobacterium stomatepiae
19 1332609 1332863 - NZ_AP018164.1 Mycobacterium shigaense
20 4340352 4340606 + NC_016948.1 Mycobacterium paraintracellulare
21 4222033 4222287 + NC_016946.1 Mycobacterium intracellulare ATCC 13950
22 1423679 1423933 - NZ_LR130759.1 Mycobacterium basiliense
23 5892758 5893012 - NZ_AP022590.1 Mycobacterium mantenii
24 5212655 5212906 - NZ_AP022573.1 Mycobacterium saskatchewanense
25 4066809 4067063 + NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
26 4083019 4083282 + NZ_CP023147.1 Mycobacterium marseillense
27 3675451 3675714 + NZ_AP024310.1 Mycobacterium heckeshornense
28 2975791 2976045 + NZ_AP022614.1 Mycobacterium parmense
29 627331 627555 - NZ_LR026975.1 Mycolicibacterium hassiacum DSM 44199
30 5224842 5225063 + NZ_CP020809.1 Mycobacterium dioxanotrophicus
31 4849159 4849413 - NZ_AP022569.1 Mycobacterium cookii
32 1652338 1652559 + NZ_AP022577.1 Mycolicibacterium aubagnense
33 5732259 5732480 + NZ_AP022579.1 Mycolicibacterium boenickei
34 4988327 4988548 - NZ_AP022567.1 Mycolicibacterium mageritense
35 5677919 5678140 - NZ_AP022616.1 Mycolicibacterium phocaicum
36 1601183 1601407 - NZ_CP011491.1 Mycolicibacterium vaccae 95051
37 2093038 2093259 - NZ_LN831039.1 Mycolicibacterium smegmatis
38 1626688 1626912 - NZ_AP022610.1 Mycolicibacterium madagascariense
39 5864799 5865023 + NZ_AP022598.1 Mycolicibacterium parafortuitum
40 2879830 2880054 + NZ_AP022586.1 Mycolicibacterium litorale
41 4117330 4117551 + NZ_CP062008.1 Mycolicibacterium mucogenicum DSM 44124
42 982166 982390 - NZ_AP022605.1 Mycobacterium doricum
43 5026442 5026666 + NZ_AP022574.1 Mycolicibacterium psychrotolerans
44 5129612 5129854 + NZ_AP022560.1 Mycolicibacterium moriokaense
45 1980958 1981182 + NZ_AP022593.1 Mycolicibacterium arabiense
46 3570461 3570685 + NZ_LR134355.1 Mycolicibacterium chitae
47 2896127 2896351 - NZ_AP022588.1 Mycolicibacterium sediminis
48 3338251 3338475 + NZ_AP022617.1 Mycolicibacterium monacense
49 6262491 6262712 + NZ_CP012150.1 Mycobacterium goodii
50 2175206 2175430 - NZ_AP022570.1 Mycolicibacterium poriferae
51 2837147 2837371 - NZ_CP043474.1 Mycobacterium grossiae
52 1554806 1555030 - NZ_LR134356.1 Mycolicibacterium aurum
53 5900856 5901098 - NZ_AP022601.1 Mycobacterium gallinarum
54 2486531 2486755 + NZ_AP022608.1 Mycolicibacterium gadium
55 3582472 3582696 + NZ_AP022612.1 Mycolicibacterium confluentis
56 719880 720104 + NZ_AP022599.1 Mycolicibacterium pulveris
57 3944377 3944601 - NZ_AP022596.1 Mycolicibacterium helvum
58 5610078 5610287 - NZ_AP022620.1 Mycolicibacterium anyangense
59 3360476 3360709 - NZ_AP022562.1 Mycobacterium novum
60 3116829 3117062 + NC_015576.1 Mycolicibacter sinensis
61 1918246 1918470 - NC_008726.1 Mycolicibacterium vanbaalenii PYR-1
62 3535541 3535795 + NZ_LT906450.1 Rhodococcus rhodochrous
63 285460 285672 + NZ_AP022595.1 Mycolicibacterium sarraceniae
64 3025240 3025473 + NZ_LT906469.1 Mycolicibacter terrae
65 1339401 1339631 - NZ_LT906483.1 Mycolicibacterium thermoresistibile
66 3715877 3716101 - NC_013441.1 Gordonia bronchialis DSM 43247
67 5106108 5106377 + NZ_CP015235.1 Rhodococcus fascians D188
68 1422037 1422249 - NZ_AP022561.1 Mycolicibacterium aichiense
69 3875750 3876004 + NZ_CP022208.1 Rhodococcus pyridinivorans
70 2345261 2345518 - NZ_AP023172.1 Rhodococcus qingshengii
71 2466457 2466690 + NZ_AP022609.1 Mycolicibacter hiberniae
72 2247535 2247759 - NZ_CP027114.1 Gordonia alkanivorans
73 3687667 3687924 - NZ_AP022600.1 Mycolicibacterium tokaiense
74 4858211 4858435 + NZ_CP059694.1 Gordonia rubripertincta
75 1938271 1938513 + NZ_AP022603.1 Mycolicibacterium fallax
76 8200550 8200780 - NZ_CP022088.2 Nocardia brasiliensis
77 5689635 5689859 + NZ_CP033972.1 Gordonia insulae
78 1581781 1582011 - NZ_AP023396.1 Nocardia wallacei
79 4419437 4419670 - NZ_CP061725.1 Micromonospora craniellae
80 1714325 1714567 - NZ_AP022618.1 Mycolicibacterium insubricum
81 6774746 6774979 + NZ_AP022870.1 Phytohabitans flavus
82 3771870 3772094 - NC_016906.1 Gordonia polyisoprenivorans VH2
83 3680262 3680486 + NZ_CP027793.1 Rhodococcus hoagii
84 4707774 4708022 + NC_006361.1 Nocardia farcinica IFM 10152
85 3980036 3980260 + NZ_CP011530.1 Mycobacteroides immunogenum
86 4475296 4475520 - NZ_CP031264.1 Streptacidiphilus bronchialis
87 3562246 3562470 + NZ_CP014955.1 Mycobacteroides abscessus
88 3237760 3237990 - NZ_CP026746.1 Nocardia cyriacigeorgica
89 608475 608708 + NZ_AP022589.1 Mycolicibacter minnesotensis
90 3289240 3289464 + NZ_CP010271.1 Mycobacteroides saopaulense
91 2870606 2870830 + NZ_AP022563.1 Mycolicibacterium duvalii
92 3629891 3630115 + NZ_AP018165.1 [Mycobacterium] stephanolepidis
93 2766379 2766612 + NZ_AP022871.1 Phytohabitans suffuscus
94 3592214 3592438 + NZ_CP007220.1 Mycobacteroides chelonae CCUG 47445
95 8369799 8370038 + NC_022657.1 Actinoplanes friuliensis DSM 7358
96 3159280 3159504 + NC_014158.1 Tsukamurella paurometabola DSM 20162
97 4599457 4599696 + NZ_CP045309.1 Micromonospora terminaliae
98 7953180 7953413 + NC_017093.1 Actinoplanes missouriensis 431
99 3553687 3553911 + NZ_CP019066.1 Tsukamurella tyrosinosolvens
100 4290511 4290741 - NZ_LS483468.1 Rhodococcus coprophilus
101 1133728 1133958 - NZ_CP039291.1 Cellulomonas shaoxiangyii
102 3358458 3358682 + NZ_CP024633.1 Mycobacteroides salmoniphilum
103 3319274 3319528 + NZ_CP029146.1 Rhodococcus ruber
104 856461 856706 - NC_013530.1 Xylanimonas cellulosilytica DSM 15894
105 3814831 3815055 + NC_015564.1 Hoyosella subflava DQS3-9A1
106 9228171 9228407 + NC_013595.1 Streptosporangium roseum DSM 43021
107 5943165 5943398 + NC_014391.1 Micromonospora aurantiaca ATCC 27029
108 2093243 2093467 - NZ_CP060716.1 Leucobacter denitrificans
109 4337359 4337601 - NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
110 3038127 3038357 + NZ_CP032698.1 Streptomyces hundungensis
111 3112819 3113061 + NZ_CP034687.1 Streptomyces griseoviridis
112 4284536 4284775 + NC_009380.1 Salinispora tropica CNB-440
113 2765352 2765591 + NC_014151.1 Cellulomonas flavigena DSM 20109
114 4957762 4957986 - NZ_CP072827.1 Streptomyces mobaraensis NBRC 13819 = DSM 40847
115 2017852 2018094 - NZ_CP008802.1 Actinotignum schaalii
116 1686304 1686534 - NZ_CP022753.1 Nocardiopsis gilva YIM 90087
117 6362225 6362464 + NZ_CP058322.1 Micromonospora carbonacea
118 1179576 1179809 - NC_015312.1 Pseudonocardia dioxanivorans CB1190
119 4940397 4940639 - NZ_CP029043.1 Streptomyces nigra
120 4445915 4446151 + NC_013757.1 Geodermatophilus obscurus DSM 43160
121 5312060 5312302 - NZ_CP072931.1 Streptomyces auratus AGR0001
122 954031 954261 - NZ_CP041695.1 Nocardia otitidiscaviarum
123 3213063 3213323 - NZ_CP011853.1 Gordonia phthalatica
124 5981829 5982071 - NZ_CP020569.1 Streptomyces gilvosporeus
125 5692411 5692653 - NZ_CP071839.1 Streptomyces cyanogenus
126 1328462 1328686 - NZ_LR131272.1 Arthrobacter agilis
127 3584314 3584553 + NZ_CP023699.1 Streptomyces kanamyceticus
128 2170730 2170966 + NC_014168.1 Segniliparus rotundus DSM 44985
129 1922476 1922727 + NZ_CP044344.1 Nocardioides cynanchi
130 6697718 6697960 - NZ_CP034539.1 Streptomyces cyaneochromogenes
131 2690012 2690236 + NZ_CP048813.1 Rhodococcus triatomae
132 5869813 5870055 - NZ_CP059991.1 Streptomyces gardneri
133 3232480 3232722 + NZ_AP023440.1 Streptomyces glomeroaurantiacus
134 2801091 2801333 + NZ_CP026952.1 Aeromicrobium chenweiae
135 9869167 9869412 - NZ_CP016793.1 Lentzea guizhouensis
136 5138909 5139151 - NZ_CP023407.1 Streptomyces fungicidicus
137 6560093 6560323 + NZ_AP017900.1 Nocardia seriolae
138 6244035 6244277 - NZ_CP023690.1 Streptomyces spectabilis
139 1086425 1086700 - NZ_CP015453.1 Dietzia psychralcaliphila
140 1835505 1835729 - NZ_CP041694.1 Cellulosimicrobium cellulans
141 775184 775417 - NZ_LS483423.1 Jonesia denitrificans
142 3668610 3668852 + NZ_CP017248.1 Streptomyces fodineus
143 6197531 6197761 + NZ_LR134352.1 Nocardia asteroides
144 1425143 1425385 - NZ_CP016279.1 Streptomyces griseochromogenes
145 5050515 5050757 - NZ_CP023693.1 Streptomyces cinereoruber
146 2521974 2522216 + NZ_CP034279.1 Streptomyces ficellus
147 2739811 2740053 + NZ_CP006842.1 Corynebacterium glyciniphilum AJ 3170
148 7148992 7149234 - NZ_CP065050.1 Streptomyces solisilvae
149 3008307 3008558 + NZ_CP049257.1 Nocardioides anomalus
150 6900580 6900822 - NZ_CP034463.1 Streptomyces aquilus
151 2861622 2861846 + NC_014830.1 Intrasporangium calvum DSM 43043
152 1067663 1067884 - NC_015671.1 Cellulomonas gilvus ATCC 13127
153 903288 903512 - NC_015588.1 Isoptericola variabilis 225
154 5346328 5346558 + NZ_CP018082.1 Nocardia mangyaensis
155 1701682 1701909 - NZ_AP019307.1 Nocardioides baekrokdamisoli
156 3340680 3340904 - NZ_CP027433.1 Gordonia iterans
157 7123661 7123903 - NZ_CP045096.1 Streptomyces phaeolivaceus
158 6140090 6140329 - NZ_CP022685.1 Streptomyces formicae
159 6375978 6376223 - NZ_CP070326.1 Streptomyces noursei
160 2940795 2941019 + NZ_CP017146.1 Marisediminicola antarctica
161 2009151 2009402 + NC_008578.1 Acidothermus cellulolyticus 11B
162 5775200 5775424 - NZ_CP021978.1 Streptomyces hawaiiensis
163 5968530 5968754 - NZ_CP015098.1 Streptomyces qaidamensis
164 3379732 3379965 + NC_015635.1 Microlunatus phosphovorus NM-1
165 3434498 3434740 + NZ_CP030073.1 Streptomyces cadmiisoli
166 3835666 3835908 + NC_003155.5 Streptomyces avermitilis MA-4680 = NBRC 14893
167 5273280 5273522 - NZ_CP012382.1 Streptomyces ambofaciens ATCC 23877
168 3070588 3070812 + NC_013521.1 Sanguibacter keddieii DSM 10542
169 1899205 1899417 - NZ_CP009896.1 Pimelobacter simplex
170 6164022 6164264 - NZ_CP047020.1 Streptomyces broussonetiae
171 5613418 5613660 - NC_021985.1 Streptomyces collinus Tu 365
172 2353778 2353999 + NZ_CP033724.1 Clavibacter michiganensis subsp. michiganensis
173 3519205 3519447 + NZ_CP023689.1 Streptomyces chartreusis
174 1169409 1169627 - NZ_CP071883.1 Curtobacterium flaccumfaciens pv. flaccumfaciens
175 2184330 2184572 + NZ_CP065253.1 Streptomyces clavuligerus
176 1251216 1251440 - NZ_AP018920.1 Pseudonocardia autotrophica
177 3483067 3483315 + NC_014165.1 Thermobispora bispora DSM 43833
178 8531009 8531251 + NZ_CP063373.1 Streptomyces ferrugineus
179 4294138 4294380 + NC_013510.1 Thermomonospora curvata DSM 43183
180 534331 534555 + NZ_CP053564.1 Pseudonocardia broussonetiae
181 5315884 5316126 - NZ_CP031194.1 Streptomyces paludis
182 1276176 1276400 - NC_015514.1 Cellulomonas fimi ATCC 484
183 1274180 1274401 + NZ_CP020715.1 Cnuibacter physcomitrellae
184 3405604 3405846 + NZ_CP032427.1 Streptomyces griseorubiginosus
185 2674310 2674534 + NZ_CP033325.1 Georgenia faecalis
186 3474608 3474850 + NZ_CP022744.1 Streptomyces lincolnensis
187 3235833 3236057 + NC_012669.1 Beutenbergia cavernae DSM 12333
188 3207487 3207729 + NZ_CP051006.1 Streptomyces griseofuscus
189 3297096 3297338 + NZ_CP023688.1 Streptomyces rimosus
190 2141665 2141898 + NZ_CP041091.1 Nocardioides sambongensis
191 1349513 1349743 - NZ_CP059164.1 Nocardioides ungokensis
192 888336 888578 + NZ_CP041146.1 Nocardioides humi
193 727090 727332 - NZ_CP045737.1 Aeromicrobium yanjiei
194 1291049 1291291 - NZ_CP051486.1 Streptomyces pratensis
195 3483849 3484091 + NC_013929.1 Streptomyces scabiei 87.22
196 2539979 2540203 + NZ_CP068013.1 Paenarthrobacter ureafaciens
197 5037740 5037964 - NZ_AP023439.1 Streptomyces tuirus
198 1142052 1142294 - NZ_CP015961.1 Dietzia timorensis
199 3183683 3183925 + NZ_CP011340.1 Streptomyces pristinaespiralis
200 2678887 2679129 + NZ_CP022310.1 Streptomyces calvus
201 6146933 6147175 - NZ_CP023694.1 Streptomyces coeruleorubidus
202 427608 427832 - NZ_CP035037.1 Leucobacter muris
203 1506670 1506894 + NZ_CP014209.1 Isoptericola dokdonensis DS-3
204 2383922 2384164 + NZ_CP048882.1 Streptomyces bathyalis
205 2647769 2647993 + NZ_CP051884.1 Cellulomonas taurus
206 1997573 1997797 + NZ_CP013745.1 Arthrobacter alpinus
207 1786883 1787125 - NZ_CP022295.1 Nocardioides aromaticivorans
208 1871381 1871623 - NC_013947.1 Stackebrandtia nassauensis DSM 44728
209 3288268 3288501 - NZ_CP047156.1 Epidermidibacterium keratini
210 1171095 1171319 + NZ_CP011005.1 Psychromicrobium lacuslunae
211 3011055 3011285 - NZ_CP060713.1 Nocardioides mesophilus
212 799104 799352 - NZ_CP006764.1 Corynebacterium doosanense CAU 212 = DSM 45436
213 3197386 3197613 + NZ_CP013290.1 Janibacter indicus
214 1300581 1300811 + NZ_CP038267.1 Nocardioides euryhalodurans
215 1235944 1236186 - NZ_CP011502.1 Aeromicrobium erythreum
216 5254981 5255223 - NZ_CP023703.1 Streptomyces galilaeus
217 2402280 2402504 + NZ_CP023202.1 Streptomyces xinghaiensis S187
218 56208 56438 + NZ_CP015079.1 Nocardioides dokdonensis FR1436
219 844657 844890 - NZ_CP009245.1 Corynebacterium aquilae DSM 44791
220 5079072 5079314 - NZ_CP029196.1 Streptomyces venezuelae
221 1073142 1073363 + NC_009664.2 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
222 6548689 6548928 + NC_008278.1 Frankia alni ACN14a
223 5617854 5618099 - NZ_CP019457.1 Streptomyces lydicus
224 5754338 5754562 + NC_013729.1 Kribbella flavida DSM 17836
225 4194829 4195053 + NZ_CP018863.1 Arthrobacter crystallopoietes
226 2857583 2857825 + NZ_CP060404.1 Streptomyces buecherae
227 1404559 1404819 + NZ_CP069485.1 Corynebacterium glucuronolyticum
228 3098088 3098312 - NC_010168.1 Renibacterium salmoninarum ATCC 33209
229 3671306 3671530 - NZ_CP035495.1 Xylanimonas allomyrinae
230 990578 990802 - NZ_CP026949.1 Mycetocola zhujimingii
231 1173596 1173826 + NZ_CP030033.1 Cryobacterium soli
232 7467622 7467876 + NZ_CP023865.1 Actinoplanes teichomyceticus ATCC 31121
233 1146177 1146437 - NZ_CP015449.1 Dietzia lutea
234 2932289 2932519 + NZ_LR134501.1 Nocardiopsis dassonvillei
235 9599294 9599542 + NZ_CP045572.1 Nonomuraea nitratireducens
236 4545923 4546162 + NC_007777.1 Frankia casuarinae
237 2793753 2793983 - NZ_CP038436.1 Nocardioides seonyuensis
238 2463605 2463829 + NZ_CP043661.1 Kribbella qitaiheensis
239 2624577 2624798 - NZ_CP035806.1 Leucobacter triazinivorans
240 959326 959556 - NC_014666.1 Frankia inefficax
241 2668967 2669203 + NZ_CP023692.1 Streptomyces vinaceus
242 2779971 2780207 + NZ_CP023701.1 Streptomyces subrutilus
243 5886744 5886980 - NZ_CP071139.1 Streptomyces nojiriensis
244 873742 873978 - NZ_CP009220.1 Corynebacterium deserti GIMN1.010
245 1755056 1755274 + NZ_CP034412.1 Glutamicibacter creatinolyticus
246 9044910 9045146 + NC_013131.1 Catenulispora acidiphila DSM 44928
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_000962.3
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00580.23 0.73 180 2724 opposite-strand UvrD/REP helicase N-terminal domain
2 PF13245.8 0.89 219 2437 opposite-strand AAA domain
3 PF00570.25 0.87 215 140 opposite-strand HRDC domain
4 PF00293.30 0.82 202 73.0 opposite-strand NUDIX domain
5 PF09297.13 0.65 160 74.0 opposite-strand NADH pyrophosphatase zinc ribbon domain
6 PF12705.9 0.65 161 5906.5 opposite-strand PD-(D/E)XK nuclease superfamily
++ More..