Result : P9WLZ0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB10 |
| NCBI Accession ID | |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MKRTNIYLDEEQTASLDKLAAQEGVSRAELIRLLLNRALTTAGDDLASDLQAINDSFGTLRHLDPPVRRSGGREQHLAQVWRATS |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC10 (By similarity). {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | CDD:419885 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WLZ0 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1574510 | 1574767 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1597761 | 1598018 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1311547 | 1311804 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 4613475 | 4613732 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 5 | 4714076 | 4714333 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 6 | 1316170 | 1316430 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 7 | 4792890 | 4793162 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 8 | 2608910 | 2609167 | + | NZ_CP018762.1 | Microbacterium aurum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 1.0 | 8 | -3.0 | same-strand | PIN domain |
++ More..