Result : A6QCQ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AP009179.1 |
| Organism | Sulfurovum sp. (strain NBC37-1) |
| Left | 2431179 |
| Right | 2431370 |
| Strand | + |
| Nucleotide Sequence | ATGAACTATATTGATTTGAAAGATAAAAGCGAAGCAGAATTGCTTGCGATGCTTAAAGAGAAAAAACTTGAATTGTTTACATTGAATGCAAAGCAGAAGACTATGCAGCTTACAAACACTTCAGAGTTGAGAGTAGCGAAAAAAGATATCGCTAGAATCCAGACAGCATTGACTGCTGCTAGAGCGAAGTAA |
| Sequence | MNYIDLKDKSEAELLAMLKEKKLELFTLNAKQKTMQLTNTSELRVAKKDIARIQTALTAARAK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 17615243 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A6QCQ6 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 96
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2139203 | 2139394 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 2 | 155452 | 155643 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 3 | 611219 | 611410 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 4 | 675313 | 675504 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 5 | 931935 | 932126 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 6 | 889268 | 889459 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 7 | 1059491 | 1059682 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 8 | 105237 | 105428 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 9 | 787111 | 787302 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 10 | 938204 | 938395 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 11 | 975353 | 975544 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 12 | 911555 | 911746 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 13 | 726745 | 726936 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 14 | 572431 | 572622 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 15 | 952291 | 952482 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 16 | 1481896 | 1482087 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 17 | 1612831 | 1613022 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 18 | 640008 | 640199 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 19 | 814652 | 814843 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 20 | 869435 | 869626 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 21 | 844273 | 844458 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 22 | 975075 | 975260 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 23 | 196856 | 197041 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 24 | 727735 | 727926 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 25 | 215617 | 215805 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 26 | 946074 | 946259 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 27 | 173485 | 173673 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 28 | 1087935 | 1088126 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 29 | 877900 | 878085 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 30 | 935698 | 935886 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 31 | 950100 | 950291 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 32 | 307765 | 307950 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 33 | 1867647 | 1867832 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 34 | 1576746 | 1576931 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 35 | 59291 | 59476 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 36 | 61930 | 62115 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 37 | 1527262 | 1527447 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 38 | 1616057 | 1616242 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 39 | 37925 | 38110 | + | NZ_CP059443.1 | Campylobacter fetus |
| 40 | 1353536 | 1353727 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 41 | 58279 | 58464 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 42 | 1850951 | 1851142 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 43 | 1671306 | 1671491 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 44 | 2021327 | 2021512 | - | NZ_CP012544.1 | Campylobacter showae |
| 45 | 68442 | 68627 | + | NZ_CP012543.1 | Campylobacter rectus |
| 46 | 61309 | 61494 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 47 | 32452 | 32637 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 48 | 70431 | 70616 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 49 | 694621 | 694806 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 50 | 63690 | 63875 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 51 | 1736960 | 1737154 | - | NZ_CP012541.1 | Campylobacter concisus |
| 52 | 1981820 | 1982008 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 53 | 2047879 | 2048073 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 54 | 1334408 | 1334596 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 55 | 1249251 | 1249436 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 56 | 15291 | 15476 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 57 | 1394171 | 1394362 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 58 | 1173460 | 1173666 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 59 | 103781 | 103966 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 60 | 1832299 | 1832484 | - | NZ_CP053826.1 | Campylobacter curvus |
| 61 | 185873 | 186055 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 62 | 158979 | 159167 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 63 | 109497 | 109682 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 64 | 1268803 | 1268991 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 65 | 1782828 | 1783013 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 66 | 1686825 | 1687010 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 67 | 91905 | 92090 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 68 | 1590885 | 1591076 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 69 | 1529995 | 1530201 | - | NC_012115.1 | Nautilia profundicola AmH |
| 70 | 586085 | 586273 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 71 | 129089 | 129289 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 72 | 1362596 | 1362796 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 73 | 842909 | 843106 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 74 | 345634 | 345840 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 75 | 1586487 | 1586693 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 76 | 424178 | 424366 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 77 | 2594620 | 2594808 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 78 | 661529 | 661723 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 79 | 2437083 | 2437271 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 80 | 152499 | 152699 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 81 | 1086514 | 1086738 | + | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 82 | 67923 | 68120 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 83 | 315639 | 315842 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 84 | 3137575 | 3137733 | - | NZ_LR699011.1 | Roseburia hominis |
| 85 | 2515211 | 2515414 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 86 | 505384 | 505587 | + | NZ_CP030280.1 | Blautia argi |
| 87 | 2571319 | 2571525 | + | NZ_CP070062.1 | Coprococcus comes |
| 88 | 1983190 | 1983393 | + | NZ_LT990039.1 | Massilistercora timonensis |
| 89 | 3429698 | 3429901 | + | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 90 | 1612479 | 1612667 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 91 | 503965 | 504168 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 92 | 1611235 | 1611426 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 93 | 339494 | 339694 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 94 | 1522307 | 1522501 | - | NZ_CP014161.1 | Aerococcus urinae |
| 95 | 754885 | 755040 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 96 | 1302481 | 1302672 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011308.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03947.20 | 0.98 | 94 | 1744.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 2 | PF00181.25 | 0.98 | 94 | 1744.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 3 | PF00203.23 | 0.98 | 94 | 1458.0 | same-strand | Ribosomal protein S19 |
| 4 | PF00237.21 | 1.0 | 96 | 1118.0 | same-strand | Ribosomal protein L22p/L17e |
| 5 | PF00189.22 | 0.99 | 95 | 415 | same-strand | Ribosomal protein S3, C-terminal domain |
| 6 | PF07650.19 | 0.98 | 94 | 415.0 | same-strand | KH domain |
| 7 | PF00252.20 | 0.98 | 94 | -13.0 | same-strand | Ribosomal protein L16p/L10e |
| 8 | PF00366.22 | 0.99 | 95 | 11 | same-strand | Ribosomal protein S17 |
| 9 | PF00238.21 | 1.0 | 96 | 262.0 | same-strand | Ribosomal protein L14p/L23e |
| 10 | PF00467.31 | 1.0 | 96 | 630.0 | same-strand | KOW motif |
| 11 | PF00673.23 | 0.98 | 94 | 870.5 | same-strand | ribosomal L5P family C-terminus |
| 12 | PF00281.21 | 1.0 | 96 | 871.0 | same-strand | Ribosomal protein L5 |
| 13 | PF00253.23 | 0.81 | 78 | 1417.0 | same-strand | Ribosomal protein S14p/S29e |
++ More..