Result : P9WLU8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein MT1596.1 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 1747072 |
| Right | 1747299 |
| Strand | + |
| Nucleotide Sequence | GTGCCGAACGGAGTGCTGGGCCTGGGCAATCCCAGCCGGCTAGCCGCGTTGTATGGGTTGCAGCTGGCGCACGAGTCGCAGTGCTGCCAGATGCACAATTTGCCCTCTGCAGCGCGACAAGTCACTGTTGCGTGTCGCGAGGAGGTGGGCATAACGACCATCCTTGCCGGCAGAGACGAATGCGGCGTGTGTGACAAGACAGCTGGGTTGGATGGCGCCGCTCCTTAG |
| Sequence | MPNGVLGLGNPSRLAALYGLQLAHESQCCQMHNLPSAARQVTVACREEVGITTILAGRDECGVCDKTAGLDGAAP |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12218036 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WLU8 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1746919 | 1747146 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1779083 | 1779310 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00849.24 | 1.0 | 2 | 3148.0 | same-strand | RNA pseudouridylate synthase |
| 2 | PF01479.27 | 1.0 | 2 | 3148.0 | same-strand | S4 domain |
| 3 | PF09864.11 | 1.0 | 2 | 2548.0 | opposite-strand | Membrane-bound lysozyme-inhibitor of c-type lysozyme |
| 4 | PF07007.14 | 1.0 | 2 | 2548.0 | opposite-strand | Lysozyme inhibitor LprI |
| 5 | PF01152.23 | 1.0 | 2 | 2083.0 | opposite-strand | Bacterial-like globin |
| 6 | PF00106.27 | 1.0 | 2 | 426.0 | same-strand | short chain dehydrogenase |
| 7 | PF08659.12 | 1.0 | 2 | 426.0 | same-strand | KR domain |
| 8 | PF13561.8 | 1.0 | 2 | 22.0 | same-strand | Enoyl-(Acyl carrier protein) reductase |
| 9 | PF10604.11 | 1.0 | 2 | 110.0 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
| 10 | PF07733.14 | 1.0 | 2 | 609.0 | same-strand | Bacterial DNA polymerase III alpha NTPase domain |
| 11 | PF17657.3 | 1.0 | 2 | 609.0 | same-strand | Bacterial DNA polymerase III alpha subunit finger domain |
| 12 | PF02811.21 | 1.0 | 2 | 609.0 | same-strand | PHP domain |
| 13 | PF14579.8 | 1.0 | 2 | 609.0 | same-strand | Helix-hairpin-helix motif |
| 14 | PF01336.27 | 1.0 | 2 | 609.0 | same-strand | OB-fold nucleic acid binding domain |
| 15 | PF01469.20 | 1.0 | 2 | 4212.0 | opposite-strand | Pentapeptide repeats (8 copies) |
| 16 | PF00823.21 | 1.0 | 2 | 4212.0 | opposite-strand | PPE family |
++ More..