Result : P9WLU3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB11 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1764755 |
| Right | 1764973 |
| Strand | + |
| Nucleotide Sequence | GTGTATCGTTGGTGTATGTCGCGCACCAACATCGACATCGATGACGAACTTGCCGCCGAGGTCATGCGCAGGTTCGGTCTGACCACCAAGAGGGCGGCGGTCGACCTTGCCCTACGACGGTTGGTCGGGTCGCCGTTGAGCCGTGAGTTTCTGCTCGGGCTGGAAGGCGTCGGCTGGGAAGGCGACCTGGATGACTTGCGAAGCGATCGCCCAGACTGA |
| Sequence | MYRWCMSRTNIDIDDELAAEVMRRFGLTTKRAAVDLALRRLVGSPLSREFLLGLEGVGWEGDLDDLRSDRPD |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin VapC11. {ECO:0000269|Pubmed:19016878, ECO:0000269|Pubmed:20011113, ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 19016878 20011113 |
| Domain | CDD:421349 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WLU3 |
| ORF Length (Amino Acid) | 72 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1764755 | 1764973 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2258030 | 2258272 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 1799198 | 1799416 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 2305189 | 2305431 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 2313221 | 2313445 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 6 | 594115 | 594342 | + | NC_015576.1 | Mycolicibacter sinensis |
| 7 | 1359875 | 1360102 | - | NZ_AP022562.1 | Mycobacterium novum |
| 8 | 2325639 | 2325863 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 9 | 2765286 | 2765528 | + | NZ_CP053564.1 | Pseudonocardia broussonetiae |
| 10 | 5656576 | 5656800 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 11 | 1627835 | 1628059 | + | NZ_CP013290.1 | Janibacter indicus |
| 12 | 4706451 | 4706672 | - | NZ_LR134501.1 | Nocardiopsis dassonvillei |
| 13 | 373711 | 373941 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
| 14 | 3652157 | 3652381 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 15 | 2462774 | 2463004 | + | NZ_CP049863.1 | Leucobacter viscericola |
| 16 | 1405667 | 1405897 | + | NZ_CP060716.1 | Leucobacter denitrificans |
| 17 | 2808505 | 2808717 | + | NZ_CP041146.1 | Nocardioides humi |
| 18 | 6158845 | 6159051 | - | NZ_CP016076.1 | Actinoalloteichus fjordicus |
| 19 | 1568998 | 1569216 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 20 | 3809804 | 3810034 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
| 21 | 1725816 | 1726061 | + | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 22 | 2266659 | 2266886 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 23 | 2670560 | 2670739 | + | NZ_CP054027.1 | Rhizobium hidalgonense |
| 24 | 2894985 | 2895164 | - | NZ_CP023705.1 | Sphingomonas melonis |
| 25 | 1085616 | 1085801 | + | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 26 | 4070986 | 4071198 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 27 | 694327 | 694506 | - | NZ_CP017940.1 | Phyllobacterium zundukense |
| 28 | 298008 | 298220 | + | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 29 | 430709 | 430915 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 30 | 537879 | 538073 | + | NC_018020.1 | Turneriella parva DSM 21527 |
| 31 | 76469 | 76672 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 32 | 660990 | 661187 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 33 | 2588108 | 2588305 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 34 | 1348198 | 1348395 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.94 | 30 | -3 | same-strand | PIN domain |
++ More..