Result : P9WLR3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv1831 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2075571 |
| Right | 2075828 |
| Strand | + |
| Nucleotide Sequence | ATGCGATTGTGTGTCTGCTCGGCAGTAGACTGGACAACGCATCGCTCTAGTGCGGGAGAGTTCTGTGGCTGCCAGCTACGGACGCCGAAGGAGCAATACCTCTCCGTCAACCTCTCAGGCACCCGGACCGCGCGAGACTACGATGCCTCTGGAAAGCGGTGGCGACCCCTGGCGGTCCTCACCCGCCGATGGGGAAAGGCGATTCACCTGACGGTGGACAGAGTCGCCGAATCTCTCAGGCGCCTGGCGTGCAGGTGA |
| Sequence | MRLCVCSAVDWTTHRSSAGEFCGCQLRTPKEQYLSVNLSGTRTARDYDASGKRWRPLAVLTRRWGKAIHLTVDRVAESLRRLACR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9634230 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WLR3 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2075571 | 2075828 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2114012 | 2114269 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1895724 | 1895954 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 2494754 | 2494999 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01597.21 | 1.0 | 4 | 3153.0 | same-strand | Glycine cleavage H-protein |
| 2 | PF00498.28 | 1.0 | 4 | 2421.5 | same-strand | FHA domain |
| 3 | PF16697.7 | 1.0 | 4 | 2421.5 | same-strand | Inner membrane component of T3SS, cytoplasmic domain |
| 4 | PF00376.25 | 1.0 | 4 | 1681.5 | same-strand | MerR family regulatory protein |
| 5 | PF13411.8 | 1.0 | 4 | 797.5 | same-strand | MerR HTH family regulatory protein |
| 6 | PF02577.16 | 1.0 | 4 | 1068.0 | same-strand | Domain of unknown function (DUF151) |
| 7 | PF02347.18 | 1.0 | 4 | 58.5 | same-strand | Glycine cleavage system P-protein |
| 8 | PF12697.9 | 0.75 | 3 | 3101 | opposite-strand | Alpha/beta hydrolase family |
| 9 | PF12146.10 | 0.75 | 3 | 3101 | opposite-strand | Serine aminopeptidase, S33 |
| 10 | PF13531.8 | 1.0 | 4 | 5819.0 | opposite-strand | Bacterial extracellular solute-binding protein |
++ More..