Result : P9WLM7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB15 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2258030 |
| Right | 2258272 |
| Strand | + |
| Nucleotide Sequence | GTGTATAGTGGTGTTGTGTCACGGACCAACATCGAGATCGACGACGAACTCGTGGCCGCCGCACAGCGGATGTACCGACTCGATTCCAAGCGAAGTGCCGTCGACCTCGCGCTGCGCCGGCTCGTGGGTGAACCGTTGGGCCGCGATGAGGCTTTGGCGCTGCAGGGCAGCGGTTTCGACTTCAGCAACGATGAGATCGAATCGTTCTCGGATACGGACCGCAAGCTCGCCGACGAGTCGTAG |
| Sequence | MYSGVVSRTNIEIDDELVAAAQRMYRLDSKRSAVDLALRRLVGEPLGRDEALALQGSGFDFSNDEIESFSDTDRKLADES |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC15 (Pubmed:20011113). Partially inhibits the RNase activity of VapC15 (Pubmed:25450593). {ECO:0000269|Pubmed:20011113, ECO:0000269|Pubmed:25450593, ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 20011113 25450593 |
| Domain | CDD:421349 |
| Functional Category | Antitoxin_type_2_and_Metal-binding |
| Uniprot ID | P9WLM7 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2258030 | 2258272 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1764755 | 1764973 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 2305189 | 2305431 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 1799198 | 1799416 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 2266659 | 2266901 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 6 | 1627835 | 1628059 | + | NZ_CP013290.1 | Janibacter indicus |
| 7 | 2325639 | 2325863 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 8 | 5656576 | 5656800 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 9 | 594115 | 594342 | + | NC_015576.1 | Mycolicibacter sinensis |
| 10 | 3652157 | 3652381 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 11 | 2313221 | 2313445 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 12 | 1359875 | 1360102 | - | NZ_AP022562.1 | Mycobacterium novum |
| 13 | 373711 | 373941 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
| 14 | 3809804 | 3810034 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.92 | 11 | 0 | same-strand | PIN domain |
++ More..