Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin VapB15 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2258030 |
Right | 2258272 |
Strand | + |
Nucleotide Sequence | GTGTATAGTGGTGTTGTGTCACGGACCAACATCGAGATCGACGACGAACTCGTGGCCGCCGCACAGCGGATGTACCGACTCGATTCCAAGCGAAGTGCCGTCGACCTCGCGCTGCGCCGGCTCGTGGGTGAACCGTTGGGCCGCGATGAGGCTTTGGCGCTGCAGGGCAGCGGTTTCGACTTCAGCAACGATGAGATCGAATCGTTCTCGGATACGGACCGCAAGCTCGCCGACGAGTCGTAG |
Sequence | MYSGVVSRTNIEIDDELVAAAQRMYRLDSKRSAVDLALRRLVGEPLGRDEALALQGSGFDFSNDEIESFSDTDRKLADES |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC15 (Pubmed:20011113). Partially inhibits the RNase activity of VapC15 (Pubmed:25450593). {ECO:0000269|Pubmed:20011113, ECO:0000269|Pubmed:25450593, ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 20011113 25450593 |
Domain | CDD:421349 |
Functional Category | Antitoxin_type_2_and_Metal-binding |
Uniprot ID | P9WLM7 |
ORF Length (Amino Acid) | 80 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2258030 | 2258272 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 1764755 | 1764973 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
3 | 2305189 | 2305431 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
4 | 1799198 | 1799416 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
5 | 2266659 | 2266901 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
6 | 1627835 | 1628059 | + | NZ_CP013290.1 | Janibacter indicus |
7 | 2325639 | 2325863 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
8 | 5656576 | 5656800 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
9 | 594115 | 594342 | + | NC_015576.1 | Mycolicibacter sinensis |
10 | 3652157 | 3652381 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
11 | 2313221 | 2313445 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
12 | 1359875 | 1360102 | - | NZ_AP022562.1 | Mycobacterium novum |
13 | 373711 | 373941 | + | NZ_CP049933.1 | Leucobacter coleopterorum |
14 | 3809804 | 3810034 | - | NZ_CP045929.1 | Saccharopolyspora coralli |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.92 | 11 | 0 | same-strand | PIN domain |