Result : P9WLE2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein MT2349 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 2559875 |
| Right | 2560099 |
| Strand | - |
| Nucleotide Sequence | GTGAACCCCGGCTTCGACGCGGTTGACCAGGAGACGGCAGCCGCGCAGGCGGTCGCCGATGCACACGGCGTCCCGTTCCTGGGAATTCGCGGTATGTCCGACGGGCCCGGCGACCCGCTGCATCTGCCGGGCTTCCCCGTCCAGTTCTTCGTTTACAAGCAGATTGCGGCCAACAACGCCGCCCGGGTCACCGAAGCCTTCCTGCAGAACTGGGCCGGCGTCTGA |
| Sequence | MNPGFDAVDQETAAAQAVADAHGVPFLGIRGMSDGPGDPLHLPGFPVQFFVYKQIAANNAARVTEAFLQNWAGV |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 12218036 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WLE2 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2618496 | 2618720 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 2564029 | 2564253 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 4180419 | 4180622 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 4 | 34540 | 34776 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 5 | 2456289 | 2456492 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 6 | 4763359 | 4763541 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 7 | 911644 | 911847 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 8 | 6166829 | 6167062 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 9 | 3608186 | 3608377 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 10 | 1466233 | 1466430 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 11 | 3406862 | 3407098 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 12 | 2197721 | 2197918 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 13 | 3517247 | 3517450 | - | NZ_LR130759.1 | Mycobacterium basiliense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00581.22 | 0.92 | 12 | 5.0 | opposite-strand | Rhodanese-like domain |
| 2 | PF12697.9 | 0.92 | 12 | 907.0 | opposite-strand | Alpha/beta hydrolase family |
++ More..