Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein MT2349 |
NCBI Accession ID | AE000516.2 |
Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
Left | 2559875 |
Right | 2560099 |
Strand | - |
Nucleotide Sequence | GTGAACCCCGGCTTCGACGCGGTTGACCAGGAGACGGCAGCCGCGCAGGCGGTCGCCGATGCACACGGCGTCCCGTTCCTGGGAATTCGCGGTATGTCCGACGGGCCCGGCGACCCGCTGCATCTGCCGGGCTTCCCCGTCCAGTTCTTCGTTTACAAGCAGATTGCGGCCAACAACGCCGCCCGGGTCACCGAAGCCTTCCTGCAGAACTGGGCCGGCGTCTGA |
Sequence | MNPGFDAVDQETAAAQAVADAHGVPFLGIRGMSDGPGDPLHLPGFPVQFFVYKQIAANNAARVTEAFLQNWAGV |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 12218036 |
Domain | |
Functional Category | Others |
Uniprot ID | P9WLE2 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2618496 | 2618720 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
2 | 2564029 | 2564253 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
3 | 4180419 | 4180622 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
4 | 34540 | 34776 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
5 | 2456289 | 2456492 | - | NZ_AP022581.1 | Mycobacterium lacus |
6 | 4763359 | 4763541 | + | NZ_AP022568.1 | Mycobacterium simiae |
7 | 911644 | 911847 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
8 | 6166829 | 6167062 | + | NZ_AP022576.1 | Mycobacterium florentinum |
9 | 3608186 | 3608377 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
10 | 1466233 | 1466430 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
11 | 3406862 | 3407098 | - | NZ_AP018164.1 | Mycobacterium shigaense |
12 | 2197721 | 2197918 | - | NZ_AP022582.1 | Mycobacterium seoulense |
13 | 3517247 | 3517450 | - | NZ_LR130759.1 | Mycobacterium basiliense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00581.22 | 0.92 | 12 | 5.0 | opposite-strand | Rhodanese-like domain |
2 | PF12697.9 | 0.92 | 12 | 907.0 | opposite-strand | Alpha/beta hydrolase family |