Result : P9WKT7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative DNA-binding protein Rv0500A |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 591111 |
| Right | 591347 |
| Strand | + |
| Nucleotide Sequence | ATGACGTCTACGAACGGGCCATCGGCGCGGGATACCGGTTTTGTTGAGGGCCAGCAGGCCAAGACACAACTTCTCACCGTGGCCGAAGTGGCGGCCCTGATGCGGGTGTCCAAGATGACGGTGTACCGGCTGGTGCACAATGGCGAACTGCCCGCGGTTCGGGTCGGGCGGTCATTCCGGGTGCATGCCAAGGCCGTCCACGACATGTTGGAGACTTCGTACTTCGACGCGGGCTAG |
| Sequence | MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02600. Profile Description: Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily. This domain is a DNA-binding helix-turn-helix domain. |
| Pubmed ID | 9634230 12368430 21969609 |
| Domain | CDD:413393 |
| Functional Category | DNA-binding |
| Uniprot ID | P9WKT7 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 137
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 591111 | 591347 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 601292 | 601528 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3881706 | 3881963 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 603374 | 603634 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 5 | 740113 | 740370 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 6 | 1383344 | 1383601 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 7 | 408937 | 409194 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 8 | 3513036 | 3513293 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 9 | 4975762 | 4976016 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 10 | 4770654 | 4770908 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 11 | 4449569 | 4449826 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 12 | 4752653 | 4752910 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 13 | 4880702 | 4880959 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 14 | 1873678 | 1873926 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 15 | 4618955 | 4619212 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 16 | 2831418 | 2831678 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 17 | 3682555 | 3682809 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 18 | 990674 | 990925 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 19 | 796850 | 797083 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 20 | 793133 | 793396 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 21 | 4257448 | 4257711 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 22 | 3212726 | 3212980 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 23 | 2492460 | 2492723 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 24 | 4583375 | 4583632 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 25 | 4226390 | 4226653 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 26 | 4217802 | 4218068 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 27 | 718881 | 719144 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 28 | 3195243 | 3195497 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 29 | 2888628 | 2888882 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 30 | 3911753 | 3912019 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 31 | 1239549 | 1239812 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 32 | 4223470 | 4223718 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 33 | 4167587 | 4167841 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 34 | 1603112 | 1603375 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 35 | 4031702 | 4031959 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 36 | 358145 | 358399 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 37 | 243416 | 243679 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 38 | 2093377 | 2093643 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 39 | 1042977 | 1043234 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 40 | 2406618 | 2406875 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 41 | 92608 | 92835 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 42 | 1058330 | 1058557 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 43 | 2819183 | 2819410 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 44 | 249386 | 249613 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 45 | 2461216 | 2461470 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 46 | 5329071 | 5329298 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 47 | 700975 | 701247 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 48 | 5016880 | 5017140 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 49 | 4831382 | 4831606 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 50 | 2412880 | 2413104 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 51 | 4917311 | 4917535 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 52 | 4965499 | 4965756 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 53 | 5880065 | 5880322 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 54 | 5150742 | 5150999 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 55 | 4297238 | 4297492 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 56 | 3960682 | 3960912 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 57 | 2363109 | 2363318 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 58 | 2263937 | 2264200 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 59 | 1563583 | 1563846 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 60 | 3042988 | 3043233 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 61 | 1057252 | 1057482 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 62 | 4949718 | 4949984 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 63 | 3647196 | 3647450 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 64 | 873550 | 873822 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 65 | 2012913 | 2013185 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 66 | 4106853 | 4107113 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 67 | 4108946 | 4109206 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 68 | 3831893 | 3832153 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 69 | 3748945 | 3749205 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 70 | 4056347 | 4056607 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 71 | 5169484 | 5169741 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 72 | 4586111 | 4586371 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 73 | 908234 | 908491 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 74 | 528696 | 528953 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 75 | 717450 | 717722 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 76 | 2800658 | 2800933 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 77 | 1432463 | 1432720 | - | NZ_AP022562.1 | Mycobacterium novum |
| 78 | 524607 | 524864 | + | NC_015576.1 | Mycolicibacter sinensis |
| 79 | 2326763 | 2327014 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 80 | 1198127 | 1198375 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 81 | 646534 | 646797 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 82 | 3192427 | 3192663 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 83 | 4951226 | 4951459 | + | NZ_CP033972.1 | Gordonia insulae |
| 84 | 3776420 | 3776665 | - | NZ_CP027433.1 | Gordonia iterans |
| 85 | 3637945 | 3638187 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 86 | 2069589 | 2069822 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 87 | 2890711 | 2890947 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 88 | 1696336 | 1696572 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 89 | 4204177 | 4204419 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 90 | 4341145 | 4341381 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 91 | 76370 | 76603 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 92 | 3839351 | 3839587 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 93 | 1069261 | 1069509 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 94 | 2328531 | 2328776 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 95 | 626080 | 626322 | + | NZ_AP017900.1 | Nocardia seriolae |
| 96 | 3987234 | 3987470 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 97 | 3860464 | 3860700 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 98 | 438612 | 438803 | + | NC_020302.1 | Corynebacterium halotolerans YIM 70093 = DSM 44683 |
| 99 | 4728106 | 4728306 | - | NZ_CP011112.1 | Luteipulveratus mongoliensis |
| 100 | 347859 | 348050 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 101 | 263314 | 263517 | + | NZ_CP019688.1 | Corynebacterium glaucum |
| 102 | 377070 | 377261 | + | NZ_LR738855.1 | Corynebacterium rouxii |
| 103 | 308345 | 308536 | + | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 104 | 1009042 | 1009278 | + | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 105 | 3607295 | 3607510 | - | NZ_CP043661.1 | Kribbella qitaiheensis |
| 106 | 2272424 | 2272696 | - | NC_015312.1 | Pseudonocardia dioxanivorans CB1190 |
| 107 | 5050457 | 5050660 | - | NC_013510.1 | Thermomonospora curvata DSM 43183 |
| 108 | 1198215 | 1198406 | + | NZ_LS483464.1 | Corynebacterium renale |
| 109 | 462338 | 462541 | + | NZ_CP045572.1 | Nonomuraea nitratireducens |
| 110 | 543742 | 543945 | + | NC_013595.1 | Streptosporangium roseum DSM 43021 |
| 111 | 364148 | 364339 | + | NZ_LT906467.1 | Corynebacterium imitans |
| 112 | 261065 | 261256 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 113 | 1104274 | 1104495 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
| 114 | 296634 | 296837 | + | NC_014165.1 | Thermobispora bispora DSM 43833 |
| 115 | 406564 | 406755 | + | NZ_LR698967.1 | Corynebacterium ammoniagenes |
| 116 | 396527 | 396718 | + | NZ_CP009251.1 | Corynebacterium stationis |
| 117 | 2062766 | 2062960 | - | NZ_CP038267.1 | Nocardioides euryhalodurans |
| 118 | 181183 | 181377 | + | NC_022198.1 | Corynebacterium argentoratense DSM 44202 |
| 119 | 1957182 | 1957388 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
| 120 | 268227 | 268418 | + | NZ_CP026948.1 | Corynebacterium liangguodongii |
| 121 | 1079470 | 1079676 | - | NZ_CP038436.1 | Nocardioides seonyuensis |
| 122 | 3294214 | 3294411 | + | NZ_CP044548.2 | Janibacter melonis |
| 123 | 7776755 | 7776979 | - | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
| 124 | 10541131 | 10541334 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 125 | 263201 | 263458 | - | NC_008578.1 | Acidothermus cellulolyticus 11B |
| 126 | 5864364 | 5864567 | - | NZ_CP022753.1 | Nocardiopsis gilva YIM 90087 |
| 127 | 567468 | 567659 | - | NZ_CP038157.1 | Corynebacterium sanguinis |
| 128 | 2133191 | 2133397 | + | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 129 | 9664175 | 9664399 | - | NC_013131.1 | Catenulispora acidiphila DSM 44928 |
| 130 | 3080146 | 3080358 | - | NZ_AP022871.1 | Phytohabitans suffuscus |
| 131 | 985425 | 985646 | + | NC_015514.1 | Cellulomonas fimi ATCC 484 |
| 132 | 5114083 | 5114328 | - | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 133 | 1680329 | 1680571 | + | NZ_CP014228.1 | Actinomyces radicidentis |
| 134 | 2794769 | 2794960 | - | NZ_CP064760.1 | Microbacterium schleiferi |
| 135 | 3963230 | 3963430 | + | NZ_CP013745.1 | Arthrobacter alpinus |
| 136 | 506349 | 506594 | + | NZ_CP066802.1 | Actinomyces weissii |
| 137 | 1558431 | 1558631 | + | NZ_CP032630.1 | Protaetiibacter intestinalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134356.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02541.18 | 0.7 | 96 | 3795.5 | same-strand | Ppx/GppA phosphatase family |
| 2 | PF01261.26 | 0.66 | 91 | 1909 | same-strand | Xylose isomerase-like TIM barrel |
| 3 | PF13622.8 | 0.61 | 83 | 1051 | same-strand | Thioesterase-like superfamily |
| 4 | PF14748.8 | 0.91 | 125 | 141 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 5 | PF03807.19 | 0.91 | 125 | 141 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 6 | PF08213.13 | 0.61 | 83 | 167 | same-strand | Mitochondrial domain of unknown function (DUF1713) |
| 7 | PF01553.23 | 0.82 | 112 | 1470.5 | same-strand | Acyltransferase |
| 8 | PF12710.9 | 0.76 | 104 | 3165.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 9 | PF00702.28 | 0.7 | 96 | 3165.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
++ More..