Result : A6QC89
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | AP009179.1 |
| Organism | Sulfurovum sp. (strain NBC37-1) |
| Left | 2253915 |
| Right | 2254124 |
| Strand | + |
| Nucleotide Sequence | ATGTCAAGAAGATGTTCAGTATCTGGAAAAGGCCCACTGGTAGGAAACAACGTTTCTCACGCAAACAACAAGACAAAAAGAAGACAGCTTCCAAACTTGAGATCGGTAAAGATCACAATGGAAGACGGAACAACTAAAAGAGTTAAGGTTGCAGCTTCTACACTTAGAACCATGAAGAAAAAAGCTGCGCAAGCTGCAGCGGCAAATTAA |
| Sequence | MSRRCSVSGKGPLVGNNVSHANNKTKRRQLPNLRSVKITMEDGTTKRVKVAASTLRTMKKKAAQAAAAN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17615243 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A6QC89 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 182
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 170645 | 170854 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 2 | 291868 | 292077 | - | NZ_CP063164.1 | Sulfurovum indicum |
| 3 | 1265235 | 1265426 | + | NZ_CP053826.1 | Campylobacter curvus |
| 4 | 1455966 | 1456157 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 5 | 731504 | 731695 | - | NZ_CP012541.1 | Campylobacter concisus |
| 6 | 829338 | 829526 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 7 | 983037 | 983231 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 8 | 1018906 | 1019100 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 9 | 1074501 | 1074695 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 10 | 136454 | 136666 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 11 | 1031137 | 1031331 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 12 | 943920 | 944114 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 13 | 1624878 | 1625066 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 14 | 1648539 | 1648727 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 15 | 2006563 | 2006751 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 16 | 1100348 | 1100539 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 17 | 960336 | 960530 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 18 | 1158443 | 1158634 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 19 | 878304 | 878495 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 20 | 723422 | 723610 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 21 | 1813965 | 1814156 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 22 | 2159498 | 2159686 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 23 | 722113 | 722307 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 24 | 752548 | 752742 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 25 | 980558 | 980749 | + | NZ_CP059443.1 | Campylobacter fetus |
| 26 | 828321 | 828512 | + | NZ_CP012543.1 | Campylobacter rectus |
| 27 | 610559 | 610750 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 28 | 1256413 | 1256607 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 29 | 1303716 | 1303907 | - | NZ_CP012544.1 | Campylobacter showae |
| 30 | 1550726 | 1550914 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 31 | 887867 | 888055 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 32 | 85273 | 85467 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 33 | 1452420 | 1452608 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 34 | 1031393 | 1031584 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 35 | 416651 | 416845 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 36 | 1738056 | 1738244 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 37 | 1956705 | 1956893 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 38 | 319981 | 320169 | + | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 39 | 1635708 | 1635902 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 40 | 477238 | 477426 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 41 | 2073641 | 2073829 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 42 | 35307 | 35501 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 43 | 326603 | 326791 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 44 | 853778 | 853972 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 45 | 1250147 | 1250335 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 46 | 426893 | 427084 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 47 | 1764698 | 1764886 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 48 | 2036526 | 2036714 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 49 | 392132 | 392326 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 50 | 368688 | 368876 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 51 | 917305 | 917493 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 52 | 1904778 | 1904966 | - | NZ_AP018676.1 | Helicobacter cinaedi |
| 53 | 312358 | 312546 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 54 | 515774 | 515962 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 55 | 702502 | 702690 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 56 | 2055680 | 2055868 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 57 | 2342186 | 2342374 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 58 | 2155635 | 2155823 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 59 | 559974 | 560162 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 60 | 2387390 | 2387578 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 61 | 1945781 | 1945969 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 62 | 2479132 | 2479320 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 63 | 1675946 | 1676134 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 64 | 497586 | 497774 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 65 | 482082 | 482270 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 66 | 387276 | 387464 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 67 | 554245 | 554433 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 68 | 764408 | 764596 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 69 | 1754730 | 1754921 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 70 | 2069633 | 2069821 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 71 | 1093621 | 1093812 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 72 | 2231961 | 2232149 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 73 | 1383552 | 1383740 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 74 | 1453622 | 1453810 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 75 | 1682958 | 1683146 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 76 | 1919375 | 1919560 | - | NC_014836.1 | Desulfurispirillum indicum S5 |
| 77 | 4569844 | 4570080 | - | NZ_LR134302.1 | Achromobacter spanius |
| 78 | 1117773 | 1118009 | - | NZ_CP016440.1 | Bordetella pseudohinzii |
| 79 | 2861763 | 2861999 | - | NZ_CP021395.1 | Bordetella hinzii |
| 80 | 3078772 | 3079008 | + | NZ_LT907988.1 | Orrella dioscoreae |
| 81 | 2680313 | 2680549 | + | NC_010645.1 | Bordetella avium 197N |
| 82 | 1814325 | 1814561 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 83 | 3819880 | 3820113 | + | NZ_CP043046.1 | Pigmentiphaga aceris |
| 84 | 711216 | 711452 | - | NZ_CP043146.1 | Bordetella holmesii |
| 85 | 3202726 | 3202962 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 86 | 1240810 | 1241046 | - | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 87 | 2398503 | 2398736 | - | NZ_CP020046.1 | Thiomonas intermedia |
| 88 | 93627 | 93827 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 89 | 2399582 | 2399818 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 90 | 1045565 | 1045801 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 91 | 1170650 | 1170886 | - | NZ_AP019378.1 | Bordetella parapertussis |
| 92 | 3219230 | 3219466 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 93 | 1903599 | 1903835 | + | NZ_CP028901.1 | Algicoccus marinus |
| 94 | 1229619 | 1229810 | + | NZ_CP018800.1 | Mariprofundus ferrinatatus |
| 95 | 43758 | 43994 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 96 | 3420424 | 3420657 | + | NZ_CP027666.1 | Ottowia oryzae |
| 97 | 545716 | 545952 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 98 | 1149930 | 1150121 | - | NZ_CP018799.1 | Mariprofundus aestuarium |
| 99 | 1396935 | 1397135 | - | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 100 | 4049442 | 4049678 | + | NZ_CP016172.1 | Bordetella flabilis |
| 101 | 977169 | 977402 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 102 | 659400 | 659636 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 103 | 3418753 | 3418989 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 104 | 3476504 | 3476740 | + | NC_010170.1 | Bordetella petrii |
| 105 | 827019 | 827252 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 106 | 1964103 | 1964339 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 107 | 2530059 | 2530250 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 108 | 1876568 | 1876804 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 109 | 1098968 | 1099204 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 110 | 2985436 | 2985672 | - | NZ_AP021881.1 | Sulfuriferula nivalis |
| 111 | 2182682 | 2182918 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 112 | 3503155 | 3503391 | + | NZ_CP018839.1 | Thauera chlorobenzoica |
| 113 | 2466469 | 2466705 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 114 | 290288 | 290476 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 115 | 2743614 | 2743844 | + | NZ_LR134378.1 | Lautropia mirabilis |
| 116 | 2259177 | 2259371 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 117 | 67925 | 68119 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 118 | 314741 | 314974 | + | NZ_LR134516.1 | Neisseria animaloris |
| 119 | 758806 | 759042 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 120 | 2327689 | 2327883 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 121 | 1474432 | 1474641 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 122 | 3109434 | 3109676 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 123 | 3099509 | 3099751 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 124 | 1675601 | 1675798 | + | NC_007759.1 | Syntrophus aciditrophicus SB |
| 125 | 323349 | 323540 | - | NZ_CP012332.1 | Vulgatibacter incomptus |
| 126 | 1884862 | 1885056 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 127 | 1372361 | 1372549 | + | NC_015499.1 | Thermodesulfobium narugense DSM 14796 |
| 128 | 4011924 | 4012118 | - | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 129 | 590425 | 590613 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 130 | 10261 | 10497 | - | NZ_CP014646.1 | Thauera humireducens |
| 131 | 1642582 | 1642779 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 132 | 210188 | 210385 | + | NZ_CP021255.1 | Desulfobulbus oralis |
| 133 | 928578 | 928811 | + | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 134 | 2770673 | 2770906 | + | NZ_CP016022.1 | Ralstonia insidiosa |
| 135 | 3686811 | 3687044 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 136 | 256816 | 257052 | - | NC_016147.2 | Pseudoxanthomonas spadix BD-a59 |
| 137 | 1394517 | 1394708 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 138 | 3934189 | 3934425 | + | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
| 139 | 4360558 | 4360797 | + | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 140 | 4597637 | 4597873 | - | NZ_CP028897.1 | Dongshaea marina |
| 141 | 1078443 | 1078682 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 142 | 4200533 | 4200724 | + | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 143 | 3687442 | 3687678 | + | NZ_CP011494.1 | Marinobacter psychrophilus |
| 144 | 6431406 | 6431594 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 145 | 4353855 | 4354091 | - | NZ_LS483377.1 | Stenotrophomonas maltophilia |
| 146 | 316465 | 316659 | + | NZ_AP012333.1 | Parascardovia denticolens DSM 10105 = JCM 12538 |
| 147 | 4510694 | 4510930 | - | NZ_CP037883.1 | Stenotrophomonas indicatrix |
| 148 | 4258416 | 4258604 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 149 | 6455081 | 6455269 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 150 | 4826656 | 4826844 | + | NZ_CP034437.1 | Paenibacillus albus |
| 151 | 468027 | 468203 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 152 | 170334 | 170570 | + | NZ_CP033326.1 | Xanthomonas cucurbitae |
| 153 | 4634762 | 4634998 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 154 | 4869649 | 4869885 | - | NZ_CP048044.1 | Xanthomonas citri |
| 155 | 2416477 | 2416713 | - | NZ_CP043476.1 | Xanthomonas hyacinthi |
| 156 | 4021886 | 4022122 | - | NZ_LT853882.1 | Xanthomonas fragariae |
| 157 | 290353 | 290589 | + | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 158 | 4664622 | 4664858 | - | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 159 | 4788835 | 4789071 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 160 | 2629012 | 2629248 | - | NZ_CP018725.1 | Xanthomonas vesicatoria ATCC 35937 |
| 161 | 3283250 | 3283486 | - | NZ_CP016878.1 | Xanthomonas hortorum |
| 162 | 1970757 | 1970948 | + | NC_014614.1 | Acetoanaerobium sticklandii |
| 163 | 1207089 | 1207277 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 164 | 284894 | 285091 | + | NZ_CP022544.1 | Bifidobacterium pseudolongum |
| 165 | 3549639 | 3549827 | - | NZ_CP011388.1 | Paenibacillus swuensis |
| 166 | 874842 | 875039 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 167 | 705423 | 705614 | + | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 168 | 951721 | 951909 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 169 | 4331697 | 4331885 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 170 | 617399 | 617605 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 171 | 4515650 | 4515856 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 172 | 2657916 | 2658104 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 173 | 2748885 | 2749073 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 174 | 2973280 | 2973468 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 175 | 941381 | 941569 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 176 | 1143978 | 1144163 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 177 | 2237376 | 2237567 | - | NC_013947.1 | Stackebrandtia nassauensis DSM 44728 |
| 178 | 1202626 | 1202814 | - | NZ_CP019870.1 | Clostridioides difficile |
| 179 | 759071 | 759265 | + | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 180 | 691767 | 691961 | + | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 181 | 1623639 | 1623827 | + | NZ_CP040676.1 | Exiguobacterium mexicanum |
| 182 | 3427227 | 3427418 | + | NZ_LT828648.1 | Nitrospira japonica |
++ More..