Result : P9WKS8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein MT0529 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 601465 |
| Right | 601758 |
| Strand | + |
| Nucleotide Sequence | ATGAGTAGGCCCCAGGTGGAGCTTTTGACTCGCGCCGGGTGCGCGATCTGCGTGCGGGTAGCGGAGCAGCTGGCCGAACTGTCCAGCGAACTGGGCTTCGACATGATGACGATCGACGTCGATGTCGCGGCGTCGACGGGCAATCCAGGGCTGCGAGCTGAGTTTGGCGATCGGTTGCCGGTGGTCCTGCTGGACGGCCGCGAGCACAGCTACTGGGAGGTCGACGAGCACCGGCTGCGTGCGGATATAGCCCGCAGCACATTTGGTAGCCCACCTGATAAACGTCTACCGTAG |
| Sequence | MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00388. Profile Description: Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold. Thioredoxins are small enzymes that participate in redox reactions, via the reversible oxidation of an active centre disulfide bond. |
| Pubmed ID | 12218036 |
| Domain | CDD:412351 |
| Functional Category | Others |
| Uniprot ID | P9WKS8 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 92
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 600098 | 600391 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 610860 | 611153 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 2881740 | 2881982 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 4 | 4456512 | 4456790 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 5 | 3876290 | 3876544 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 6 | 996153 | 996398 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 7 | 749360 | 749617 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 8 | 609201 | 609470 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 9 | 1427557 | 1427817 | - | NZ_AP022562.1 | Mycobacterium novum |
| 10 | 529578 | 529838 | + | NC_015576.1 | Mycolicibacter sinensis |
| 11 | 3188264 | 3188506 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 12 | 2422927 | 2423169 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 13 | 3203540 | 3203785 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 14 | 1068869 | 1069111 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 15 | 1377349 | 1377591 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 16 | 4780074 | 4780343 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 17 | 2367957 | 2368217 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 18 | 4982861 | 4983130 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 19 | 2477569 | 2477811 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 20 | 787878 | 788138 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 21 | 1864645 | 1864902 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 22 | 4954048 | 4954308 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 23 | 3676476 | 3676718 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 24 | 5173982 | 5174236 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 25 | 4238665 | 4238925 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 26 | 4044840 | 4045082 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 27 | 4251973 | 4252227 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 28 | 5155040 | 5155294 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 29 | 3965079 | 3965315 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 30 | 1202769 | 1203023 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 31 | 4969770 | 4970036 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 32 | 3048351 | 3048632 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 33 | 533634 | 533909 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 34 | 4302217 | 4302492 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 35 | 2097734 | 2097976 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 36 | 2268245 | 2268505 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 37 | 4835943 | 4836179 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 38 | 723302 | 723544 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 39 | 4912553 | 4912789 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 40 | 362449 | 362685 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 41 | 7672585 | 7672824 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 42 | 1061625 | 1061864 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 43 | 2322117 | 2322398 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 44 | 4337017 | 4337307 | - | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 45 | 2408286 | 2408522 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 46 | 1559270 | 1559554 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 47 | 5012613 | 5012873 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 48 | 3983133 | 3983423 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 49 | 5875700 | 5875936 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 50 | 3642941 | 3643183 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 51 | 88143 | 88385 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 52 | 2796327 | 2796569 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 53 | 2332702 | 2332986 | + | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 54 | 7275554 | 7275814 | + | NZ_CP022088.2 | Nocardia brasiliensis |
| 55 | 5324613 | 5324858 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 56 | 4163324 | 4163575 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 57 | 630161 | 630400 | + | NZ_AP017900.1 | Nocardia seriolae |
| 58 | 650922 | 651161 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 59 | 705357 | 705599 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 60 | 81347 | 81598 | - | NZ_LR134352.1 | Nocardia asteroides |
| 61 | 2075690 | 2075938 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 62 | 1062751 | 1062993 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 63 | 4219080 | 4219352 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 64 | 3856340 | 3856630 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 65 | 68007 | 68255 | - | NZ_CP027114.1 | Gordonia alkanivorans |
| 66 | 4047805 | 4048059 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 67 | 6650637 | 6650888 | - | NZ_CP018082.1 | Nocardia mangyaensis |
| 68 | 1700560 | 1700799 | + | NZ_AP023172.1 | Rhodococcus qingshengii |
| 69 | 1075757 | 1076020 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 70 | 2814805 | 2815044 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 71 | 5471124 | 5471363 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 72 | 244929 | 245174 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 73 | 4538360 | 4538614 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 74 | 3739434 | 3739688 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 75 | 3907444 | 3907680 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 76 | 4099240 | 4099494 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 77 | 3821007 | 3821261 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 78 | 877935 | 878177 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 79 | 4097123 | 4097377 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 80 | 4199949 | 4200212 | - | NZ_CP027793.1 | Rhodococcus hoagii |
| 81 | 3771951 | 3772187 | - | NZ_CP027433.1 | Gordonia iterans |
| 82 | 912538 | 912813 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 83 | 2895325 | 2895585 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 84 | 239157 | 239399 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 85 | 1201239 | 1201490 | + | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 86 | 3188225 | 3188464 | - | NZ_CP048813.1 | Rhodococcus triatomae |
| 87 | 1243941 | 1244177 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 88 | 4806368 | 4806616 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 89 | 2870683 | 2870958 | - | NZ_CP015961.1 | Dietzia timorensis |
| 90 | 674076 | 674315 | + | NC_015564.1 | Hoyosella subflava DQS3-9A1 |
| 91 | 3112324 | 3112581 | - | NZ_CP015453.1 | Dietzia psychralcaliphila |
| 92 | 3632430 | 3632669 | - | NZ_CP011853.1 | Gordonia phthalatica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022581.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13452.8 | 0.65 | 60 | 1084.5 | opposite-strand | N-terminal half of MaoC dehydratase |
| 2 | PF12710.9 | 0.95 | 87 | 113 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00702.28 | 0.91 | 84 | 110.0 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 4 | PF05201.17 | 0.99 | 91 | 123 | same-strand | Glutamyl-tRNAGlu reductase, N-terminal domain |
| 5 | PF01488.22 | 0.99 | 91 | 123 | same-strand | Shikimate / quinate 5-dehydrogenase |
| 6 | PF00745.22 | 0.99 | 91 | 123 | same-strand | Glutamyl-tRNAGlu reductase, dimerisation domain |
| 7 | PF01379.22 | 0.98 | 90 | 1517.5 | same-strand | Porphobilinogen deaminase, dipyromethane cofactor binding domain |
| 8 | PF03900.17 | 0.99 | 91 | 1519 | same-strand | Porphobilinogen deaminase, C-terminal domain |
| 9 | PF02602.17 | 0.99 | 91 | 2483 | same-strand | Uroporphyrinogen-III synthase HemD |
| 10 | PF00590.22 | 0.99 | 91 | 2483 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 11 | PF00490.23 | 0.89 | 82 | 4206.5 | same-strand | Delta-aminolevulinic acid dehydratase |
| 12 | PF01553.23 | 0.75 | 69 | 1603 | same-strand | Acyltransferase |
++ More..