Result : P9WKS5
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv0634A |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 731113 |
| Right | 731364 |
| Strand | + |
| Nucleotide Sequence | TTGGGGTCTGACTGTGGGTGCGGTGGGTATCTTTGGTCCATGCTGAAGAGGGTCGAGATAGAGGTTGATGACGACCTTATCCAAAAGGTCATCCGGCGGTACCGTGTGAAGGGTGCGCGCGAGGCTGTCAACCTTGCGCTGCGAACGTTGCTCGGCGAGGCGGATACCGCGGAGCATGGGCACGATGACGAGTACGACGAGTTCAGCGATCCCAATGCCTGGGTTCCGCGGCGGAGCCGCGACACAGGGTGA |
| Sequence | MGSDCGCGGYLWSMLKRVEIEVDDDLIQKVIRRYRVKGAREAVNLALRTLLGEADTAEHGHDDEYDEFSDPNAWVPRRSRDTG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl26582. Profile Description: Bacterial antitoxin of type II TA system, VapB. VapB is the antitoxin of a bacterial toxin-antitoxin gene pair. The cognate toxin is VapC, pfam05016. The family contains several related antitoxins from Cyanobacteria and Actinobacterial families. Antitoxins of this class carry an N-terminal ribbon-helix-helix domain, RHH, that is highly conserved across all type II bacterial antitoxins, which dimerizes with the RHH domain of a second VapB molecule. A hinge section follows the RHH, with an additional pair of flexible alpha helices at the C-terminus. This C-terminus is the Toxin-binding region of the dimer, and so is specific to the cognate toxin, whereas the RHH domain has the specific function of lying across the RNA-binding groove of the toxin dimer and inactivating the active-site - a more general function of all antitoxins. |
| Pubmed ID | 9634230 11500470 21969609 |
| Domain | CDD:421349 |
| Functional Category | Others |
| Uniprot ID | P9WKS5 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 731113 | 731364 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 740650 | 740901 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3768053 | 3768262 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 704431 | 704646 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 5 | 2239924 | 2240139 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 6 | 2638826 | 2639035 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 7 | 2597795 | 2598004 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 8 | 1204693 | 1204902 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 9 | 4502696 | 4502902 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 10 | 3552175 | 3552381 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 11 | 4921008 | 4921217 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 12 | 4638963 | 4639172 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 13 | 1274418 | 1274624 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 14 | 3073622 | 3073837 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 15 | 4452259 | 4452465 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 16 | 1142153 | 1142368 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 17 | 4623177 | 4623383 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 18 | 4757078 | 4757284 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 19 | 4240373 | 4240582 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 20 | 1779831 | 1780037 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 21 | 2769719 | 2769925 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 22 | 557861 | 558073 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 23 | 3072522 | 3072725 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 24 | 921392 | 921610 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 25 | 3396842 | 3397048 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 26 | 5121291 | 5121500 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 27 | 634045 | 634263 | - | NZ_AP022606.1 | Mycobacterium branderi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00378.22 | 0.67 | 18 | 1765.0 | opposite-strand | Enoyl-CoA hydratase/isomerase |
| 2 | PF00753.29 | 1.0 | 27 | 111 | opposite-strand | Metallo-beta-lactamase superfamily |
| 3 | PF00471.22 | 1.0 | 27 | 348 | same-strand | Ribosomal protein L33 |
| 4 | PF13452.8 | 1.0 | 27 | 1013.0 | same-strand | N-terminal half of MaoC dehydratase |
| 5 | PF01575.21 | 0.96 | 26 | 1029.0 | same-strand | MaoC like domain |
| 6 | PF00584.22 | 1.0 | 27 | 2312 | same-strand | SecE/Sec61-gamma subunits of protein translocation complex |
++ More..