Result : P9WKR1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv0879c |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 978481 |
| Right | 978756 |
| Strand | - |
| Nucleotide Sequence | ATGAGCGTCGAAAATAGTCAGATTCGCGAGCCGCCACCGCTACCACCCGTGCTGCTCGAGGTGTGGCCGGTGATCGCGGTCGGCGCGCTCGCCTGGCTGGTCGCCGCGGTGGCCGCATTCGTCGTGCCTGGCCTCGCAAGTTGGCGTCCGGTGACAGTGGCCGGGCTGGCAACAGGGTTGCTCGGCACGACCATCTTCGTCTGGCAGCTCGCCGCTGCCCGCCGTGGCGCACGCGGCGCACAAGCCGGACTCGAAACCTATCTCGACCCGAAATAG |
| Sequence | MSVENSQIREPPPLPPVLLEVWPVIAVGALAWLVAAVAAFVVPGLASWRPVTVAGLATGLLGTTIFVWQLAAARRGARGAQAGLETYLDPK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9634230 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WKR1 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 51
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 978481 | 978756 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 983588 | 983863 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 953763 | 954044 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 4 | 3204283 | 3204558 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 5 | 1122770 | 1123042 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 6 | 2522943 | 2523170 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 7 | 2478465 | 2478740 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 8 | 508192 | 508473 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 9 | 5240508 | 5240789 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 10 | 5528115 | 5528402 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 11 | 435026 | 435307 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 12 | 6160929 | 6161174 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 13 | 4896478 | 4896753 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 14 | 4784498 | 4784773 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 15 | 4888686 | 4888961 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 16 | 6225638 | 6225901 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 17 | 5472323 | 5472598 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 18 | 5391453 | 5391704 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 19 | 2727283 | 2727558 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 20 | 865391 | 865666 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 21 | 769794 | 770030 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 22 | 2138663 | 2138938 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 23 | 4617501 | 4617776 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 24 | 850612 | 850866 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 25 | 5337062 | 5337328 | - | NZ_AP022586.1 | Mycolicibacterium litorale |
| 26 | 3509722 | 3509961 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 27 | 2455110 | 2455355 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 28 | 2592877 | 2593107 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 29 | 2354278 | 2354541 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 30 | 5884251 | 5884517 | - | NZ_AP022617.1 | Mycolicibacterium monacense |
| 31 | 2369596 | 2369823 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 32 | 3067329 | 3067595 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 33 | 5788418 | 5788648 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 34 | 5535598 | 5535873 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 35 | 5376451 | 5376720 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 36 | 5360471 | 5360716 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 37 | 4459393 | 4459668 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 38 | 4303824 | 4304081 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 39 | 4853780 | 4854049 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 40 | 371444 | 371719 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 41 | 3362982 | 3363257 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 42 | 3509352 | 3509627 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 43 | 3724715 | 3724993 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 44 | 852219 | 852494 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 45 | 864030 | 864305 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 46 | 877817 | 878092 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 47 | 4666225 | 4666500 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 48 | 2997800 | 2998090 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 49 | 2145312 | 2145560 | + | NZ_CP033972.1 | Gordonia insulae |
| 50 | 4698925 | 4699173 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 51 | 672163 | 672390 | - | NC_006361.1 | Nocardia farcinica IFM 10152 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022583.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10969.10 | 0.88 | 45 | 3095 | same-strand | Protein of unknown function (DUF2771) |
| 2 | PF07690.18 | 0.92 | 47 | 1491 | same-strand | Major Facilitator Superfamily |
| 3 | PF11228.10 | 0.96 | 49 | 476 | opposite-strand | Protein of unknown function (DUF3027) |
| 4 | PF01047.24 | 0.78 | 40 | 127.5 | opposite-strand | MarR family |
| 5 | PF12802.9 | 0.78 | 40 | 127.5 | opposite-strand | MarR family |
| 6 | PF00588.21 | 0.98 | 50 | 551.0 | opposite-strand | SpoU rRNA Methylase family |
| 7 | PF10801.10 | 0.98 | 50 | 1399.5 | opposite-strand | Protein of unknown function (DUF2537) |
| 8 | PF11268.10 | 0.9 | 46 | 1680.5 | same-strand | Protein of unknown function (DUF3071) |
| 9 | PF00266.21 | 0.84 | 43 | 2607 | same-strand | Aminotransferase class-V |
| 10 | PF10604.11 | 0.69 | 35 | 23 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
++ More..