Result : P9WKQ9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv0882 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 980225 |
| Right | 980509 |
| Strand | + |
| Nucleotide Sequence | GTGAACGATCAGCGCGACCAAGCCGTGCCCTGGGCAACGGGTTTGGCGGTCGCCGGCTTCGTCGCCGCAGTCATCGCGGTTGCGGTCGTGGTGCTGAGCCTCGGCCTGATCCGCGTGCATCCGCTGTTGGCCGTCGGTCTCAACATTGTGGCGGTCAGCGGGTTGGCCCCTACGCTGTGGGGCTGGCGCCGCACCCCAGTGCTGCGCTGGTTCGTGCTTGGCGCGGCAGTGGGCGTGGCGGGCGCGTGGTTGGCGCTGCTCGCCTTGACGTTGGGGGACGGCTAG |
| Sequence | MNDQRDQAVPWATGLAVAGFVAAVIAVAVVVLSLGLIRVHPLLAVGLNIVAVSGLAPTLWGWRRTPVLRWFVLGAAVGVAGAWLALLALTLGDG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9634230 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WKQ9 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 80
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 980225 | 980509 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 985332 | 985616 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 5754085 | 5754330 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 4 | 4898176 | 4898412 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 5 | 52779 | 53060 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 6 | 4664542 | 4664829 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 7 | 2136232 | 2136474 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 8 | 867178 | 867450 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 9 | 3202515 | 3202754 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 10 | 2999468 | 2999713 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 11 | 1124413 | 1124658 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 12 | 3361212 | 3361451 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 13 | 3485221 | 3485451 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 14 | 5475433 | 5475669 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 15 | 3507567 | 3507806 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 16 | 3206586 | 3206855 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 17 | 4619148 | 4619435 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 18 | 1203743 | 1203979 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 19 | 5375243 | 5375530 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 20 | 5786740 | 5786976 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 21 | 2355936 | 2356172 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 22 | 1849682 | 1849924 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 23 | 852313 | 852546 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 24 | 1116749 | 1116982 | - | NZ_AP022562.1 | Mycobacterium novum |
| 25 | 869512 | 869745 | + | NC_015576.1 | Mycolicibacter sinensis |
| 26 | 6223985 | 6224224 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 27 | 952112 | 952351 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 28 | 807600 | 807833 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 29 | 2725658 | 2725891 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 30 | 853974 | 854270 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 31 | 3246757 | 3246990 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 32 | 4303522 | 4303761 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 33 | 2521147 | 2521386 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 34 | 3161733 | 3161972 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 35 | 4887090 | 4887320 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 36 | 506382 | 506669 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 37 | 865713 | 866018 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 38 | 879500 | 879805 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 39 | 5238698 | 5238985 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 40 | 373163 | 373450 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 41 | 4662890 | 4663126 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 42 | 5526305 | 5526592 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 43 | 3725888 | 3726169 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 44 | 821274 | 821546 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 45 | 1152816 | 1153049 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 46 | 3065722 | 3065955 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 47 | 2371319 | 2371564 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 48 | 5390279 | 5390521 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 49 | 5043086 | 5043358 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 50 | 309050 | 309283 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 51 | 1470094 | 1470339 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 52 | 2456248 | 2456523 | + | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 53 | 4157113 | 4157346 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 54 | 6159336 | 6159608 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 55 | 5027510 | 5027743 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 56 | 3638492 | 3638725 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 57 | 2686712 | 2686990 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 58 | 3508110 | 3508343 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 59 | 2577003 | 2577236 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 60 | 798631 | 798942 | + | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 61 | 718490 | 718723 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 62 | 4786210 | 4786443 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 63 | 737336 | 737647 | + | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 64 | 860455 | 860703 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 65 | 736491 | 736769 | + | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 66 | 802862 | 803173 | + | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 67 | 4093545 | 4093784 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 68 | 5885928 | 5886173 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 69 | 971614 | 971862 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 70 | 3191811 | 3192044 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 71 | 2594538 | 2594774 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 72 | 674277 | 674507 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 73 | 1069638 | 1069919 | + | NZ_CP029146.1 | Rhodococcus ruber |
| 74 | 295207 | 295440 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 75 | 3747923 | 3748168 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 76 | 1495911 | 1496144 | + | NZ_LR134352.1 | Nocardia asteroides |
| 77 | 1201530 | 1201802 | + | NZ_CP027793.1 | Rhodococcus hoagii |
| 78 | 5251569 | 5251844 | - | NC_013235.1 | Nakamurella multipartita DSM 44233 |
| 79 | 1488524 | 1488796 | + | NZ_CP022208.1 | Rhodococcus pyridinivorans |
| 80 | 676489 | 676737 | + | NZ_CP018082.1 | Nocardia mangyaensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP025546.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF11228.10 | 0.81 | 65 | 2168 | same-strand | Protein of unknown function (DUF3027) |
| 2 | PF10745.11 | 0.97 | 78 | 1408.5 | opposite-strand | Protein of unknown function (DUF2530) |
| 3 | PF01047.24 | 0.7 | 56 | 882.5 | same-strand | MarR family |
| 4 | PF12802.9 | 0.7 | 56 | 882.5 | same-strand | MarR family |
| 5 | PF00588.21 | 1.0 | 80 | 36.0 | same-strand | SpoU rRNA Methylase family |
| 6 | PF11268.10 | 0.96 | 77 | 12 | opposite-strand | Protein of unknown function (DUF3071) |
| 7 | PF00266.21 | 0.89 | 71 | 926 | opposite-strand | Aminotransferase class-V |
| 8 | PF11583.10 | 0.8 | 64 | 2267.0 | same-strand | P-aminobenzoate N-oxygenase AurF |
| 9 | PF00037.29 | 0.72 | 58 | 3305.0 | same-strand | 4Fe-4S binding domain |
| 10 | PF12837.9 | 0.72 | 58 | 3305.0 | same-strand | 4Fe-4S binding domain |
| 11 | PF12838.9 | 0.71 | 57 | 3304 | same-strand | 4Fe-4S dicluster domain |
| 12 | PF13187.8 | 0.71 | 57 | 3304 | same-strand | 4Fe-4S dicluster domain |
| 13 | PF10604.11 | 0.72 | 58 | 1696.0 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
++ More..