ProsmORF-pred
Result : P9WKP4
Protein Information
Information Type Description
Protein name Uncharacterized protein MT0921.1
NCBI Accession ID AE000516.2
Organism Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Left 1002453
Right 1002716
Strand -
Nucleotide Sequence ATGGGCAAGGGACGCAAACCGACAGACAGCGAGACCCTGGCACACATCCGTGACCTGGTGGCCGAGGAGAAGGCGTTGCGAGCGCAGCTGCGGCACGGTGGCATCAGCGAGTCCGAGGAGCAGCAGCAACTGCGCCGCATCGAGATCGAACTCGACCAGTGCTGGGACCTGCTCCGACAGCGACGGGCATTGCGCCAAACCGGTGGTGACCCGCGCGAAGCAGTCGTGCGTCCCGCCGACCAAGTCGAGGGGTACACCGGCTAG
Sequence MGKGRKPTDSETLAHIRDLVAEEKALRAQLRHGGISESEEQQQLRRIEIELDQCWDLLRQRRALRQTGGDPREAVVRPADQVEGYTG
Source of smORF Swiss-Prot
Function The ORF matches to the profile of pfam10944. Profile Description: Protein of unknown function (DUF2630). This bacterial family of proteins have no known function.
Pubmed ID 12218036
Domain CDD:402498
Functional Category Others
Uniprot ID P9WKP4
ORF Length (Amino Acid) 87
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 103
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1002441 1002704 - NC_000962.3 Mycobacterium tuberculosis H37Rv
2 1007547 1007810 - NC_015848.1 Mycobacterium canettii CIPT 140010059
3 392523 392786 - NZ_AP022581.1 Mycobacterium lacus
4 4644239 4644502 + NZ_LR130759.1 Mycobacterium basiliense
5 3350270 3350533 + NZ_AP022582.1 Mycobacterium seoulense
6 3191688 3191951 + NZ_AP022619.1 Mycobacterium paraseoulense
7 5513703 5513966 + NZ_AP022572.1 Mycobacterium shottsii
8 5223031 5223294 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
9 490718 490981 + NZ_CP058277.1 Mycobacterium marinum
10 2713629 2713892 + NZ_AP022573.1 Mycobacterium saskatchewanense
11 4908886 4909143 - NZ_AP022587.1 Mycobacterium stomatepiae
12 4629936 4630193 - NZ_AP022576.1 Mycobacterium florentinum
13 2120766 2121029 + NC_022663.1 Mycobacterium kansasii ATCC 12478
14 3496013 3496276 - NZ_AP022568.1 Mycobacterium simiae
15 3010899 3011162 - NZ_AP022615.1 Mycobacterium heidelbergense
16 865845 866108 - NZ_CP023147.1 Mycobacterium marseillense
17 5721895 5722158 + NZ_CP025546.1 Mycobacterium paragordonae
18 877742 878005 - NC_016946.1 Mycobacterium intracellulare ATCC 13950
19 891529 891792 - NC_016948.1 Mycobacterium paraintracellulare
20 4863764 4864018 + NZ_AP022613.1 Mycobacterium conspicuum
21 5486275 5486538 - NZ_AP022614.1 Mycobacterium parmense
22 5550334 5550597 - NZ_AP022590.1 Mycobacterium mantenii
23 940243 940506 + NZ_AP022583.1 Mycobacterium noviomagense
24 877929 878192 - NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
25 4440034 4440297 + NZ_AP018164.1 Mycobacterium shigaense
26 2382138 2382401 - NZ_AP022606.1 Mycobacterium branderi
27 2509018 2509263 + NZ_AP022569.1 Mycobacterium cookii
28 3192198 3192461 + NZ_AP022620.1 Mycolicibacterium anyangense
29 2707784 2708002 - NZ_AP022600.1 Mycolicibacterium tokaiense
30 3179512 3179760 - NZ_AP022599.1 Mycolicibacterium pulveris
31 1866673 1866891 - NZ_AP022574.1 Mycolicibacterium psychrotolerans
32 867719 867967 - NZ_AP022561.1 Mycolicibacterium aichiense
33 1489067 1489315 - NZ_AP022560.1 Mycolicibacterium moriokaense
34 3488875 3489093 + NZ_AP022608.1 Mycolicibacterium gadium
35 3267671 3267919 - NZ_AP022596.1 Mycolicibacterium helvum
36 452097 452360 - NZ_AP022612.1 Mycolicibacterium confluentis
37 3617403 3617621 + NZ_AP022601.1 Mycobacterium gallinarum
38 5900909 5901127 - NZ_AP022617.1 Mycolicibacterium monacense
39 3177831 3178049 + NZ_AP022605.1 Mycobacterium doricum
40 5006866 5007084 + NZ_LR134356.1 Mycolicibacterium aurum
41 4837396 4837614 + NZ_AP022610.1 Mycolicibacterium madagascariense
42 5354286 5354504 - NZ_AP022586.1 Mycolicibacterium litorale
43 5358342 5358590 + NZ_AP022570.1 Mycolicibacterium poriferae
44 3732957 3733175 + NZ_LR026975.1 Mycolicibacterium hassiacum DSM 44199
45 4680036 4680284 - NZ_AP022565.1 Mycolicibacterium alvei
46 5025537 5025785 + NZ_CP011491.1 Mycolicibacterium vaccae 95051
47 6125804 6126052 + NZ_CP020809.1 Mycobacterium dioxanotrophicus
48 6203643 6203891 + NZ_AP022588.1 Mycolicibacterium sediminis
49 292766 293014 + NZ_CP043474.1 Mycobacterium grossiae
50 4807099 4807347 - NZ_AP022593.1 Mycolicibacterium arabiense
51 2611726 2611974 - NZ_CP012150.1 Mycobacterium goodii
52 5769853 5770101 + NZ_LN831039.1 Mycolicibacterium smegmatis
53 1250087 1250335 - NZ_CP011269.1 Mycolicibacterium fortuitum
54 5364574 5364792 + NC_008726.1 Mycolicibacterium vanbaalenii PYR-1
55 2477708 2477956 - NZ_AP022598.1 Mycolicibacterium parafortuitum
56 2380651 2380899 - NZ_AP022579.1 Mycolicibacterium boenickei
57 1127451 1127699 + NZ_AP022567.1 Mycolicibacterium mageritense
58 3140919 3141179 + NZ_LT828648.1 Nitrospira japonica
59 1154216 1154449 - NZ_LT828648.1 Nitrospira japonica
60 3685864 3686115 - NC_013441.1 Gordonia bronchialis DSM 43247
61 3719202 3719450 - NC_013729.1 Kribbella flavida DSM 17836
62 5706202 5706450 + NZ_CP033972.1 Gordonia insulae
63 8146458 8146703 + NZ_CP051486.1 Streptomyces pratensis
64 1783381 1783629 - NZ_CP045737.1 Aeromicrobium yanjiei
65 956779 957024 + NC_013510.1 Thermomonospora curvata DSM 43183
66 4112128 4112376 - NZ_CP045529.1 Luteimicrobium xylanilyticum
67 679937 680182 - NZ_CP048813.1 Rhodococcus triatomae
68 1058957 1059205 + NZ_CP043661.1 Kribbella qitaiheensis
69 3928794 3929036 - NZ_CP023702.1 Streptomyces nitrosporeus
70 5334944 5335189 + NZ_AP022870.1 Phytohabitans flavus
71 1323113 1323361 - NZ_CP059164.1 Nocardioides ungokensis
72 1964063 1964311 - NZ_CP026952.1 Aeromicrobium chenweiae
73 3413303 3413569 + NZ_CP031194.1 Streptomyces paludis
74 1326117 1326356 - NC_014165.1 Thermobispora bispora DSM 43833
75 3867301 3867546 + NZ_CP013738.1 Streptomyces globisporus C-1027
76 809789 810034 + NZ_AP022871.1 Phytohabitans suffuscus
77 2409229 2409474 - NZ_CP045572.1 Nonomuraea nitratireducens
78 2269108 2269338 - NC_012669.1 Beutenbergia cavernae DSM 12333
79 3855549 3855797 + NC_014830.1 Intrasporangium calvum DSM 43043
80 5918757 5919020 + NZ_CP063374.1 Streptomyces chromofuscus
81 402225 402473 - NZ_CP041694.1 Cellulosimicrobium cellulans
82 8063701 8063949 + NZ_CP034687.1 Streptomyces griseoviridis
83 4647466 4647708 + NZ_CP029146.1 Rhodococcus ruber
84 4433436 4433681 - NC_010572.1 Streptomyces griseus subsp. griseus NBRC 13350
85 6456312 6456557 - NC_019673.1 Saccharothrix espanaensis DSM 44229
86 8414388 8414618 - NZ_CP016793.1 Lentzea guizhouensis
87 8156932 8157177 + NZ_CP045643.1 Streptomyces fagopyri
88 4513194 4513436 - NZ_LT906450.1 Rhodococcus rhodochrous
89 2721334 2721579 - NZ_CP011801.1 Nitrospira moscoviensis
90 8890325 8890570 + NZ_CP023690.1 Streptomyces spectabilis
91 2632586 2632831 - NC_009664.2 Kineococcus radiotolerans SRS30216 = ATCC BAA-149
92 3501283 3501528 - NZ_CP019066.1 Tsukamurella tyrosinosolvens
93 5705733 5705978 + NC_014666.1 Frankia inefficax
94 4084576 4084818 + NZ_CP010407.1 Streptomyces vietnamensis
95 4785617 4785859 - NZ_CP022208.1 Rhodococcus pyridinivorans
96 120831 121076 - NC_020990.1 Streptomyces albidoflavus
97 5465747 5465971 - NZ_CP022521.1 Actinoalloteichus hoggarensis
98 6550934 6551188 - NZ_CP031264.1 Streptacidiphilus bronchialis
99 4381625 4381861 + NZ_CP059991.1 Streptomyces gardneri
100 3694100 3694336 + NZ_CP029196.1 Streptomyces venezuelae
101 2381947 2382201 + NZ_CP022753.1 Nocardiopsis gilva YIM 90087
102 3804534 3804770 + NZ_CP023693.1 Streptomyces cinereoruber
103 2314487 2314753 + NC_016111.1 Streptomyces cattleya NRRL 8057 = DSM 46488
104 3057096 3057341 - NZ_CP012752.1 Kibdelosporangium phytohabitans
++ More..