Result : P9WKL9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein Rv0968 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1078391 |
| Right | 1078687 |
| Strand | + |
| Nucleotide Sequence | ATGGTGTGGCATGGATTCCTAGCGAAGGCGGTACCCACCGTGGTCACCGGCGCGGTGGGGGTCGCGGCGTATGAGGCGCTGCGCAAGATGGTGGTGAAGGCTCCGCTGCGGGCGGCAACCGTGTCCGTTGCCGCCTGGGGCATACGCTTAGCACGTGAAGCCGAGCGCAAGGCCGGGGAGAGCGCCGAGCAAGCTCGACTGATGTTCGCCGACGTGCTAGCCGAAGCCAGCGAGCGCGCCGGGGAAGAAGTTCCACCACTGGCGGTGGCGGGTTCGGACGACGGTCATGACCACTGA |
| Sequence | MVWHGFLAKAVPTVVTGAVGVAAYEALRKMVVKAPLRAATVSVAAWGIRLAREAERKAGESAEQARLMFADVLAEASERAGEEVPPLAVAGSDDGHDH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam07371. Profile Description: Protein of unknown function (DUF1490). This family consists of several hypothetical bacterial proteins of around 90 residues in length. Members of the family seem to be found exclusively in Mycobacterium species. The function of this family is unknown. |
| Pubmed ID | 9634230 16586367 21969609 |
| Domain | CDD:399979 |
| Functional Category | Others |
| Uniprot ID | P9WKL9 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 54
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1078391 | 1078687 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3650273 | 3650515 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 2237303 | 2237575 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 4 | 1088618 | 1088914 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 3707557 | 3707799 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 6 | 2284463 | 2284735 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 7 | 3142007 | 3142303 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 8 | 2724850 | 2725131 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 9 | 1397212 | 1397502 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 10 | 3577690 | 3577965 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 11 | 1003448 | 1003726 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 12 | 5169898 | 5170194 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 13 | 1412532 | 1412813 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 14 | 4571204 | 4571446 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 15 | 4637637 | 4637918 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 16 | 5529562 | 5529846 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 17 | 836744 | 836983 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 18 | 444347 | 444628 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 19 | 3453339 | 3453623 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 20 | 2754017 | 2754289 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 21 | 3089555 | 3089836 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 22 | 15197 | 15472 | - | NZ_CP025547.1 | Mycobacterium paragordonae |
| 23 | 17067 | 17372 | + | NZ_CP025547.1 | Mycobacterium paragordonae |
| 24 | 3110414 | 3110698 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 25 | 3170850 | 3171134 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 26 | 4521794 | 4522084 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 27 | 5120203 | 5120484 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 28 | 5670296 | 5670580 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 29 | 2969176 | 2969460 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 30 | 632660 | 632938 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 31 | 5271091 | 5271372 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 32 | 1357064 | 1357342 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 33 | 5459169 | 5459450 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 34 | 316492 | 316773 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 35 | 2776507 | 2776791 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 36 | 2246496 | 2246780 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 37 | 6133440 | 6133724 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 38 | 5500441 | 5500725 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 39 | 2569119 | 2569397 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 40 | 2973699 | 2973980 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 41 | 1529417 | 1529737 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 42 | 3762871 | 3763152 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 43 | 3198373 | 3198648 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 44 | 5353267 | 5353509 | - | NZ_LR134356.1 | Mycolicibacterium aurum |
| 45 | 4156805 | 4157086 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 46 | 904525 | 904806 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 47 | 944947 | 945228 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 48 | 2110014 | 2110310 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 49 | 1530539 | 1530820 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 50 | 3251581 | 3251862 | - | NZ_AP022562.1 | Mycobacterium novum |
| 51 | 1811257 | 1811541 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 52 | 2603091 | 2603372 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 53 | 4307858 | 4308139 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 54 | 2425232 | 2425474 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 55 | 2414216 | 2414527 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 56 | 4442185 | 4442466 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 57 | 3197784 | 3198065 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 58 | 3227411 | 3227692 | + | NC_015576.1 | Mycolicibacter sinensis |
| 59 | 2264928 | 2265209 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 60 | 4196420 | 4196701 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 61 | 750271 | 750552 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 62 | 2337275 | 2337556 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 63 | 2632433 | 2632714 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 64 | 1338173 | 1338451 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 65 | 5838075 | 5838353 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 66 | 1990584 | 1990835 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 67 | 1580235 | 1580513 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 68 | 5465725 | 5465976 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 69 | 2971495 | 2971773 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 70 | 728956 | 729207 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 71 | 1261394 | 1261681 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 72 | 2780642 | 2780926 | + | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 73 | 869820 | 870065 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 74 | 4757635 | 4757919 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 75 | 605457 | 605738 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 76 | 6035905 | 6036189 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 77 | 1231452 | 1231715 | - | NZ_AP018164.1 | Mycobacterium shigaense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 1.0 | 54 | 9 | same-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 1.0 | 54 | 9 | same-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00483.25 | 0.61 | 33 | 4197 | opposite-strand | Nucleotidyl transferase |
| 4 | PF13641.8 | 0.67 | 36 | 3309.0 | opposite-strand | Glycosyltransferase like family 2 |
| 5 | PF00535.28 | 0.67 | 36 | 3309.0 | opposite-strand | Glycosyl transferase family 2 |
| 6 | PF04321.19 | 0.67 | 36 | 2410.0 | opposite-strand | RmlD substrate binding domain |
| 7 | PF01370.23 | 0.67 | 36 | 2415.0 | opposite-strand | NAD dependent epimerase/dehydratase family |
| 8 | PF03816.16 | 0.67 | 36 | 836.5 | same-strand | LytR cpsA psr family |
| 9 | PF13399.8 | 0.67 | 36 | 836.5 | same-strand | LytR cell envelope-related transcriptional attenuator |
++ More..