Result : P9WK08
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Metallothionein (MT) (Copper-binding metallothionein) (Cu(I)-binding metallothionein) (Mycobacterial metallothionein) |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 218502 |
| Right | 218663 |
| Strand | - |
| Nucleotide Sequence | ATGAGGGTGATACGAATGACGAACTACGAGGCTGGGACCTTGCTGACCTGCAGCCACGAGGGCTGTGGCTGTCGGGTTCGCATCGAAGTCCCATGCCACTGTGCTGGCGCCGGTGACGCCTACCGCTGCACCTGCGGCGACGAATTGGCCCCGGTCAAGTAG |
| Sequence | MRVIRMTNYEAGTLLTCSHEGCGCRVRIEVPCHCAGAGDAYRCTCGDELAPVK |
| Source of smORF | Swiss-Prot |
| Function | Metallothioneins are small proteins that have a high content of cysteine residues wich allow them to bind heavy metal ions through clusters of thiolate bonds. MymT binds up to seven ions of Cu(+), with a preference for four to six Cu(+) ions, in a solvent-shielded core. MymT protects M.tuberculosis from copper toxicity (By similarity). {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | |
| Functional Category | Metal-binding |
| Uniprot ID | P9WK08 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 225115 | 225276 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 218390 | 218551 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 3883584 | 3883730 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 4 | 4579254 | 4579400 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 5 | 6194830 | 6194991 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 6 | 1289201 | 1289347 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 7 | 3570085 | 3570246 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 8 | 5147309 | 5147455 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 9 | 5248438 | 5248584 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 10 | 4384795 | 4384941 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 11 | 4942567 | 4942722 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 12 | 349559 | 349720 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 13 | 4990113 | 4990259 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 14 | 1803324 | 1803473 | + | NZ_AP022562.1 | Mycobacterium novum |
| 15 | 154466 | 154615 | - | NC_015576.1 | Mycolicibacter sinensis |
| 16 | 1709509 | 1709670 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 17 | 570948 | 571109 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 18 | 1930489 | 1930650 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 19 | 243169 | 243315 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 20 | 2251925 | 2252086 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 21 | 3608765 | 3608911 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 22 | 4285220 | 4285375 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 23 | 3958936 | 3959091 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 24 | 384485 | 384631 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 25 | 1787489 | 1787635 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 26 | 4057606 | 4057752 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 27 | 4678864 | 4679019 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 28 | 3286227 | 3286373 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 29 | 507961 | 508107 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 30 | 3592776 | 3592922 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 31 | 2051231 | 2051380 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 32 | 2081929 | 2082081 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 33 | 3032568 | 3032714 | - | NZ_CP029543.1 | Mycobacterium leprae |
| 34 | 3529407 | 3529556 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 35 | 141068 | 141217 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 36 | 2018213 | 2018362 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 37 | 1965864 | 1966010 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 38 | 3733324 | 3733464 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 39 | 1936528 | 1936677 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 40 | 1976734 | 1976883 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 41 | 5770369 | 5770518 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 42 | 2151406 | 2151549 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04542.16 | 0.64 | 27 | 4381 | same-strand | Sigma-70 region 2 |
| 2 | PF08281.14 | 0.62 | 26 | 4376.0 | same-strand | Sigma-70, region 4 |
| 3 | PF04545.18 | 0.62 | 26 | 4376.0 | same-strand | Sigma-70, region 4 |
| 4 | PF12146.10 | 0.79 | 33 | 3488 | opposite-strand | Serine aminopeptidase, S33 |
| 5 | PF12697.9 | 0.79 | 33 | 3488 | opposite-strand | Alpha/beta hydrolase family |
| 6 | PF10979.10 | 0.81 | 34 | 2669.0 | opposite-strand | Protein of unknown function (DUF2786) |
| 7 | PF01915.24 | 0.67 | 28 | 41.0 | opposite-strand | Glycosyl hydrolase family 3 C-terminal domain |
| 8 | PF14310.8 | 0.67 | 28 | 41.0 | opposite-strand | Fibronectin type III-like domain |
| 9 | PF13578.8 | 0.62 | 26 | 132.0 | opposite-strand | Methyltransferase domain |
| 10 | PF00920.23 | 0.81 | 34 | 1494.0 | same-strand | Dehydratase family |
| 11 | PF02583.19 | 0.76 | 32 | 3592.0 | opposite-strand | Metal-sensitive transcriptional repressor |
++ More..