Result : P9WJG6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein ArfB |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 1003817 |
| Right | 1003969 |
| Strand | + |
| Nucleotide Sequence | ATGGATTTTGTGATCCAGTGGTCGTGCTACCTGCTGGCGTTCCTGGGGGGCTCGGCTGTTGCCTGGGTAGTCGTCACTCTGTCGATCAAGCGCGCCAGCCGTGATGAGGGTGCTGCGGAGGCGCCCAGTGCAGCCGAGACAGGCGCACAGTGA |
| Sequence | MDFVIQWSCYLLAFLGGSAVAWVVVTLSIKRASRDEGAAEAPSAAETGAQ |
| Source of smORF | Swiss-Prot |
| Function | Required for wild-type expression of ArfA and ammonia secretion, not however part of an ammonia transporter. {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P9WJG6 |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1008911 | 1009063 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 1003805 | 1003957 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 1135897 | 1136049 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 4 | 2383450 | 2383602 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 5 | 3494999 | 3495160 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 6 | 820393 | 820545 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 7 | 800355 | 800510 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 8 | 1104928 | 1105080 | - | NZ_AP022562.1 | Mycobacterium novum |
| 9 | 881402 | 881554 | + | NC_015576.1 | Mycolicibacter sinensis |
| 10 | 939216 | 939368 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 11 | 453962 | 454117 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 12 | 2382479 | 2382634 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 13 | 1251911 | 1252060 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 14 | 4681834 | 4681989 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 15 | 2588883 | 2589035 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 16 | 393916 | 394068 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 17 | 3183859 | 3184011 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 18 | 1125771 | 1125926 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 19 | 80767 | 80907 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 20 | 3012286 | 3012438 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 21 | 4808362 | 4808517 | + | NZ_AP022593.1 | Mycolicibacterium arabiense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LT906469.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00285.23 | 0.67 | 14 | 2978 | same-strand | Citrate synthase, C-terminal domain |
| 2 | PF00691.22 | 0.81 | 17 | 13 | same-strand | OmpA family |
| 3 | PF02518.28 | 0.9 | 19 | 544 | opposite-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 4 | PF00512.27 | 0.9 | 19 | 544 | opposite-strand | His Kinase A (phospho-acceptor) domain |
| 5 | PF00672.27 | 0.9 | 19 | 544 | opposite-strand | HAMP domain |
| 6 | PF00072.26 | 1.0 | 21 | 1851 | opposite-strand | Response regulator receiver domain |
| 7 | PF00486.30 | 1.0 | 21 | 1851 | opposite-strand | Transcriptional regulatory protein, C terminal |
| 8 | PF00254.30 | 0.62 | 13 | 1182 | same-strand | FKBP-type peptidyl-prolyl cis-trans isomerase |
++ More..