Result : P9WJ91
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Probable antitoxin MazE4 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1686271 |
| Right | 1686573 |
| Strand | + |
| Nucleotide Sequence | GTGCCGTTTCTGGTTGCATTATCCGGTATCATCTCGGGCGTGCGTGATCATTCGATGACCGTGCGGCTCGACCAGCAAACTCGCCAGCGCCTGCAAGACATTGTGAAAGGCGGATACCGGAGCGCTAATGCGGCGATCGTCGACGCCATCAACAAGCGCTGGGAGGCGCTACACGATGAGCAACTCGACGCCGCCTACGCGGCCGCGATCCATGACAATCCGGCGTACCCGTACGAGTCTGAGGCCGAACGGAGCGCCGCGCGGGCCCGGCGCAACGCCAGGCAGCAGCGCTCGGCACAGTGA |
| Sequence | MPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYESEAERSAARARRNARQQRSAQ |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. In M.smegmatis neutralizes the toxic effect of mRNA interferase MazF4, its cognate toxin, on growth. {ECO:0000269|Pubmed:20724443}. |
| Pubmed ID | 9634230 16611633 20724443 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ91 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1686271 | 1686573 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1710442 | 1710744 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09335.13 | 1.0 | 2 | 4305.0 | opposite-strand | SNARE associated Golgi protein |
| 2 | PF01642.24 | 1.0 | 2 | 1140.5 | same-strand | Methylmalonyl-CoA mutase |
| 3 | PF02310.21 | 1.0 | 2 | 14.0 | same-strand | B12 binding domain |
| 4 | PF02452.19 | 1.0 | 2 | -3.0 | same-strand | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
| 5 | PF03308.18 | 1.0 | 2 | 311.0 | same-strand | Methylmalonyl Co-A mutase-associated GTPase MeaB |
| 6 | PF02492.21 | 1.0 | 2 | 311.0 | same-strand | CobW/HypB/UreG, nucleotide-binding domain |
| 7 | PF00144.26 | 1.0 | 2 | 1371.0 | same-strand | Beta-lactamase |
| 8 | PF08241.14 | 1.0 | 2 | 2730.0 | opposite-strand | Methyltransferase domain |
| 9 | PF13649.8 | 1.0 | 2 | 2730.0 | opposite-strand | Methyltransferase domain |
| 10 | PF13847.8 | 1.0 | 2 | 2730.0 | opposite-strand | Methyltransferase domain |
| 11 | PF08242.14 | 1.0 | 2 | 2730.0 | opposite-strand | Methyltransferase domain |
| 12 | PF07311.14 | 1.0 | 2 | 3561.0 | opposite-strand | Dodecin |
++ More..