Result : A6QBY2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L32 |
| NCBI Accession ID | AP009179.1 |
| Organism | Sulfurovum sp. (strain NBC37-1) |
| Left | 2132861 |
| Right | 2133022 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGTACCTAAGAGACGAGTGAGTCATACAAGAGCAGCGAAAAGAAGAACACACTACAAGTTGACACTTCCTATGCCTGTAAAAGATGCAGACGGAACATGGAGAATGCCTCACCACATGAACATGACAACCGGTGAGTACAAAACGACCAAAGCATAA |
| Sequence | MAVPKRRVSHTRAAKRRTHYKLTLPMPVKDADGTWRMPHHMNMTTGEYKTTKA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17615243 |
| Domain | CDD:415589 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A6QBY2 |
| ORF Length (Amino Acid) | 53 |
++ More..
| Conservation Analysis |
No. of Species: 118
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 391159 | 391320 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 2 | 388380 | 388541 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 3 | 227210 | 227362 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 4 | 2598431 | 2598583 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 5 | 212328 | 212480 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 6 | 2511330 | 2511482 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 7 | 210715 | 210861 | + | NZ_CP059443.1 | Campylobacter fetus |
| 8 | 1498477 | 1498623 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 9 | 241503 | 241649 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 10 | 1342498 | 1342644 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 11 | 1536910 | 1537062 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 12 | 285275 | 285421 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 13 | 270341 | 270493 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 14 | 291720 | 291872 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 15 | 298317 | 298463 | - | NZ_CP012544.1 | Campylobacter showae |
| 16 | 2178294 | 2178440 | + | NZ_CP012543.1 | Campylobacter rectus |
| 17 | 1524414 | 1524560 | + | NZ_CP012541.1 | Campylobacter concisus |
| 18 | 1560234 | 1560380 | + | NZ_CP053826.1 | Campylobacter curvus |
| 19 | 441478 | 441630 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 20 | 2409807 | 2409959 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 21 | 354172 | 354324 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 22 | 406576 | 406728 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 23 | 1896831 | 1896977 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 24 | 2425803 | 2425955 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 25 | 265282 | 265434 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 26 | 1857378 | 1857527 | - | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 27 | 496163 | 496312 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 28 | 174366 | 174512 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 29 | 2247767 | 2247919 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 30 | 332855 | 333004 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 31 | 293886 | 294038 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 32 | 1891941 | 1892093 | + | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 33 | 1405776 | 1405922 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 34 | 224674 | 224820 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 35 | 1656029 | 1656181 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 36 | 274936 | 275088 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 37 | 403479 | 403631 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 38 | 395024 | 395176 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 39 | 2770714 | 2770866 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 40 | 2500744 | 2500896 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 41 | 1491361 | 1491507 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 42 | 2441439 | 2441591 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 43 | 2506212 | 2506364 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 44 | 2433978 | 2434130 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 45 | 333806 | 333958 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 46 | 392930 | 393082 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 47 | 848277 | 848429 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 48 | 1891761 | 1891916 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 49 | 2678493 | 2678645 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 50 | 1621050 | 1621205 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 51 | 1737069 | 1737221 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 52 | 1354045 | 1354191 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 53 | 658674 | 658823 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 54 | 2184624 | 2184773 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 55 | 1957427 | 1957579 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 56 | 1934405 | 1934557 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 57 | 1247949 | 1248095 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 58 | 1097301 | 1097453 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 59 | 1286147 | 1286293 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 60 | 1283142 | 1283288 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 61 | 1403168 | 1403314 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 62 | 1578350 | 1578496 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 63 | 300842 | 300988 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 64 | 1656818 | 1656967 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 65 | 401250 | 401396 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 66 | 1881395 | 1881544 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 67 | 1179168 | 1179320 | - | NZ_CP021886.1 | Helicobacter apodemus |
| 68 | 314204 | 314356 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 69 | 1663731 | 1663883 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 70 | 577984 | 578130 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 71 | 242239 | 242397 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 72 | 1446470 | 1446616 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 73 | 1076459 | 1076605 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 74 | 69546 | 69692 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 75 | 681194 | 681340 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 76 | 330459 | 330605 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 77 | 195425 | 195571 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 78 | 54507 | 54656 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 79 | 295816 | 295965 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 80 | 1519180 | 1519329 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 81 | 374293 | 374442 | - | NC_012115.1 | Nautilia profundicola AmH |
| 82 | 384396 | 384545 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 83 | 4553645 | 4553818 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 84 | 2799146 | 2799319 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 85 | 785250 | 785423 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 86 | 1567394 | 1567567 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 87 | 3506843 | 3507016 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 88 | 1343599 | 1343772 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 89 | 4355197 | 4355370 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 90 | 3825035 | 3825208 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 91 | 2750372 | 2750545 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 92 | 2539668 | 2539841 | + | NZ_CP021780.1 | Paenibacillus donghaensis |
| 93 | 912440 | 912613 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 94 | 2608753 | 2608926 | + | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 95 | 3024857 | 3025030 | + | NZ_CP009288.1 | Paenibacillus durus |
| 96 | 3026616 | 3026789 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 97 | 5261909 | 5262082 | + | NZ_CP048429.1 | Paenibacillus jilunlii |
| 98 | 3355085 | 3355258 | + | NZ_CP009287.1 | Paenibacillus graminis |
| 99 | 5260224 | 5260397 | + | NZ_CP068595.1 | Paenibacillus sonchi |
| 100 | 3732024 | 3732197 | + | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 101 | 3847434 | 3847607 | + | NZ_CP009285.1 | Paenibacillus borealis |
| 102 | 2776749 | 2776922 | + | NZ_CP009286.1 | Paenibacillus stellifer |
| 103 | 4003695 | 4003868 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 104 | 6090049 | 6090222 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 105 | 2609470 | 2609643 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 106 | 572043 | 572213 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 107 | 1226710 | 1226883 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 108 | 1598936 | 1599109 | + | NZ_CP027770.1 | Staphylococcus felis |
| 109 | 6400738 | 6400911 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 110 | 3571920 | 3572093 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 111 | 612945 | 613127 | - | NC_014817.1 | Asticcacaulis excentricus CB 48 |
| 112 | 1339709 | 1339894 | - | NC_022549.1 | Acholeplasma brassicae |
| 113 | 3302786 | 3302959 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 114 | 2707246 | 2707419 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 115 | 1565799 | 1565981 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 116 | 1748652 | 1748819 | - | NZ_CP068170.1 | Erysipelatoclostridium ramosum |
| 117 | 944850 | 945026 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 118 | 368582 | 368758 | + | NZ_LR134484.1 | Gemella haemolysans |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011308.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00334.21 | 0.69 | 81 | 393 | same-strand | Nucleoside diphosphate kinase |
| 2 | PF02504.17 | 0.9 | 106 | 6.0 | same-strand | Fatty acid synthesis protein |
| 3 | PF08541.12 | 0.91 | 107 | 1021 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
| 4 | PF08545.12 | 0.91 | 107 | 1021 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |
++ More..