Result : P9WJ87
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin MazE6 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2234643 |
| Right | 2234891 |
| Strand | - |
| Nucleotide Sequence | ATGAAGACAGCTATTTCTCTGCCGGATGAGACGTTCGATCGGGTATCGCGGCGTGCGAGTGAGCTCGGCATGAGTCGGTCCGAGTTCTTCACGAAGGCTGCGCAGCGCTACCTGCACGAGCTGGACGCCCAATTGCTCACGGGCCAGATCGACAGGGCTCTAGAGAGCATCCATGGCACCGACGAAGCGGAGGCCCTCGCCGTGGCCAACGCATACCGCGTGCTAGAAACCATGGACGATGAGTGGTGA |
| Sequence | MKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQIDRALESIHGTDEAEALAVANAYRVLETMDDEW |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and in M.smegmatis counteracts the ribonuclease activity of cognate toxin MazF6. {ECO:0000269|Pubmed:17623030, ECO:0000269|Pubmed:18258191, ECO:0000269|Pubmed:19016878, ECO:0000269|Pubmed:20011113, ECO:0000269|Pubmed:20876537}. |
| Pubmed ID | 9634230 15718296 16611633 17623030 18258191 19016878 20011113 20876537 21969609 25608501 |
| Domain | CDD:425357 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P9WJ87 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2234643 | 2234891 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2281803 | 2282051 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3112578 | 3112826 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 41791 | 42051 | + | NZ_CP025547.1 | Mycobacterium paragordonae |
| 5 | 2005060 | 2005308 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 6 | 921401 | 921649 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02452.19 | 0.83 | 5 | -4.5 | same-strand | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
++ More..