Result : P9WJ58
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB3 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 642090 |
| Right | 642356 |
| Strand | - |
| Nucleotide Sequence | TTGTTGAGCCGGCGCACGAAAACGATCGTTGTGTGTACATTGGTGTGTATGGCTCGGTTGAACGTGTATGTGCCCGACGAATTGGCGGAGCGCGCCAGGGCGCGGGGCTTGAACGTCTCGGCGCTGACTCAGGCCGCGATCAGTGCCGAGTTGGAGAACTCCGCAACCGATGCGTGGCTTGAGGGGTTGGAACCCAGAAGCACCGGCGCTCGGCATGATGACGTGCTGGGTGCGATCGATGCCGCTCGCGATGAGTTCGAAGCGTGA |
| Sequence | MLSRRTKTIVVCTLVCMARLNVYVPDELAERARARGLNVSALTQAAISAELENSATDAWLEGLEPRSTGARHDDVLGAIDAARDEFEA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | CDD:413231 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ58 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 640638 | 640904 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 654110 | 654376 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1896005 | 1896241 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 4 | 471859 | 472095 | + | NZ_AP022605.1 | Mycobacterium doricum |
| 5 | 4681041 | 4681259 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 6 | 77678 | 77926 | + | NZ_AP018921.1 | Pseudonocardia autotrophica |
| 7 | 4753754 | 4753975 | + | NZ_CP045929.1 | Saccharopolyspora coralli |
| 8 | 5172849 | 5173070 | - | NZ_CP022752.1 | Actinopolyspora erythraea |
| 9 | 2736488 | 2736718 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 10 | 1137079 | 1137306 | + | NZ_CP016353.1 | Prauserella marina |
| 11 | 6006115 | 6006339 | + | NZ_CP018082.1 | Nocardia mangyaensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.91 | 10 | -3.0 | same-strand | PIN domain |
++ More..