Result : P9WJ55
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB9 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1073327 |
| Right | 1073548 |
| Strand | + |
| Nucleotide Sequence | ATGAAGACGCTGTATCTGCGCAATGTGCCGGACGACGTGGTCGAGCGACTCGAGCGCCTCGCCGAACTCGCCAAGACGTCGGTGTCCGCGGTTGCTGTGCGTGAGCTCACCGAGGCTTCTCGCCGCGCCGACAATCCGGCGCTTCTTGGGGACTTGCCCGATATCGGCATCGACACGACCGAACTGATCGGTGGTATCGACGCCGAGCGCGCCGGTCGATGA |
| Sequence | MKTLYLRNVPDDVVERLERLAELAKTSVSAVAVRELTEASRRADNPALLGDLPDIGIDTTELIGGIDAERAGR |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC9. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ55 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1073327 | 1073548 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1083534 | 1083755 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 287550 | 287771 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 4 | 3591781 | 3591996 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 5 | 1466959 | 1467174 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 6 | 2595297 | 2595518 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 7 | 2586916 | 2587131 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 8 | 1825083 | 1825298 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 9 | 2579080 | 2579295 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.67 | 6 | -3.0 | same-strand | PIN domain |
++ More..