Protein Information |
Information Type | Description |
---|---|
Protein name | Putative antitoxin VapB9 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 1073327 |
Right | 1073548 |
Strand | + |
Nucleotide Sequence | ATGAAGACGCTGTATCTGCGCAATGTGCCGGACGACGTGGTCGAGCGACTCGAGCGCCTCGCCGAACTCGCCAAGACGTCGGTGTCCGCGGTTGCTGTGCGTGAGCTCACCGAGGCTTCTCGCCGCGCCGACAATCCGGCGCTTCTTGGGGACTTGCCCGATATCGGCATCGACACGACCGAACTGATCGGTGGTATCGACGCCGAGCGCGCCGGTCGATGA |
Sequence | MKTLYLRNVPDDVVERLERLAELAKTSVSAVAVRELTEASRRADNPALLGDLPDIGIDTTELIGGIDAERAGR |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC9. {ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 |
Domain | |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P9WJ55 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1073327 | 1073548 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 1083534 | 1083755 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
3 | 287550 | 287771 | - | NZ_AP022606.1 | Mycobacterium branderi |
4 | 3591781 | 3591996 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
5 | 1466959 | 1467174 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
6 | 2595297 | 2595518 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
7 | 2586916 | 2587131 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
8 | 1825083 | 1825298 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
9 | 2579080 | 2579295 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.67 | 6 | -3.0 | same-strand | PIN domain |