Result : P9WJ53
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB12 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1947416 |
| Right | 1947643 |
| Strand | - |
| Nucleotide Sequence | ATGTCCGCCATGGTTCAGATCCGCAACGTTCCCGACGAGCTTCTCCACGAGCTGAAGGCCCGCGCAGCGGCGCAACGGATGAGCCTGAGCGATTTCCTCCTAGCACGGCTTGCCGAGATCGCGGAAGAACCGGCCCTCGACGACGTTCTCGACCGTCTAGCGGCACTGCCGCGCCGGGATCTCGGCGCGAGCGCAGCCGAGCTTGTTGACGAGGCTCGATCTGAGTGA |
| Sequence | MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRDLGASAAELVDEARSE |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC12. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 21969609 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ53 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1947416 | 1947643 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1008236 | 1008463 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 3 | 1746039 | 1746266 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 4997489 | 4997716 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 1.0 | 4 | -3 | same-strand | PIN domain |
++ More..