Result : P9WJ49
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB17 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2851091 |
| Right | 2851318 |
| Strand | + |
| Nucleotide Sequence | ATGACCGTAAAGAGGACCACGATTGAGCTGGACGAAGATCTTGTGCGGGCAGCCCAGGCCGTCACCGGGGAAACATTGCGAGCGACGGTCGAGCGCGCGCTGCAGCAGCTGGTGGCCGCGGCTGCCGAGCAGGCCGCCGCGCGCCGGCGGCGGATCGTCGACCATCTCGCGCACGCCGGCACTCACGTGGACGCAGACGTGCTGCTCTCCGAGCAGGCGTGGCGATGA |
| Sequence | MTVKRTTIELDEDLVRAAQAVTGETLRATVERALQQLVAAAAEQAAARRRRIVDHLAHAGTHVDADVLLSEQAWR |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC17. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 21969609 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ49 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2851091 | 2851318 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2920183 | 2920410 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 2085628 | 2085813 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 2247651 | 2247878 | - | NZ_AP022562.1 | Mycobacterium novum |
| 5 | 4365820 | 4366047 | + | NC_015576.1 | Mycolicibacter sinensis |
| 6 | 1379341 | 1379568 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 7 | 930885 | 931070 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 8 | 4777617 | 4777844 | + | NC_015635.1 | Microlunatus phosphovorus NM-1 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.75 | 6 | 2949 | same-strand | PIN domain |
++ More..