Result : P9WJ47
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB18 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2867783 |
| Right | 2868061 |
| Strand | + |
| Nucleotide Sequence | GTGAGCACCACCATCGTTGCTGGCGTGATCCAGGGTCACCTGCCGGTGATCCTGCCCACGCGCAGGCGGGCTCGCGATCTCGGGCACACGACGGCGTTATTTCGGGCGCAAACGCTCCAATGCATATATCTCAGTATCGAATACCTATATGTTTGCTCCATGTCTCGGCGTACAACGATCGACATCGATGACATACTGCTGGCCCGCGCGCAAGCGGCGCTCGGTACCACCGGGCTGAAGGACAGGGTCGATGCCGCTTTGCGAGCCGCGGTGCGCTAG |
| Sequence | MSTTIVAGVIQGHLPVILPTRRRARDLGHTTALFRAQTLQCIYLSIEYLYVCSMSRRTTIDIDDILLARAQAALGTTGLKDRVDAALRAAVR |
| Source of smORF | Swiss-Prot |
| Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC18. {ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 |
| Domain | CDD:421349 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ47 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2867783 | 2868061 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2937470 | 2937748 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10824.10 | 1.0 | 2 | 3247.0 | same-strand | Excreted virulence factor EspC, type VII ESX diderm |
| 2 | PF06259.14 | 1.0 | 2 | 1705.0 | same-strand | Alpha/beta hydrolase |
| 3 | PF16708.7 | 1.0 | 2 | 656 | same-strand | Lipoprotein confined to pathogenic Mycobacterium |
| 4 | PF01850.23 | 1.0 | 2 | 799.0 | same-strand | PIN domain |
| 5 | PF01402.23 | 1.0 | 2 | 530.0 | same-strand | Ribbon-helix-helix protein, copG family |
++ More..