Protein Information |
Information Type | Description |
---|---|
Protein name | Putative antitoxin VapB18 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 2867783 |
Right | 2868061 |
Strand | + |
Nucleotide Sequence | GTGAGCACCACCATCGTTGCTGGCGTGATCCAGGGTCACCTGCCGGTGATCCTGCCCACGCGCAGGCGGGCTCGCGATCTCGGGCACACGACGGCGTTATTTCGGGCGCAAACGCTCCAATGCATATATCTCAGTATCGAATACCTATATGTTTGCTCCATGTCTCGGCGTACAACGATCGACATCGATGACATACTGCTGGCCCGCGCGCAAGCGGCGCTCGGTACCACCGGGCTGAAGGACAGGGTCGATGCCGCTTTGCGAGCCGCGGTGCGCTAG |
Sequence | MSTTIVAGVIQGHLPVILPTRRRARDLGHTTALFRAQTLQCIYLSIEYLYVCSMSRRTTIDIDDILLARAQAALGTTGLKDRVDAALRAAVR |
Source of smORF | Swiss-Prot |
Function | Putative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC18. {ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 |
Domain | CDD:421349 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P9WJ47 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2867783 | 2868061 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2937470 | 2937748 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF10824.10 | 1.0 | 2 | 3247.0 | same-strand | Excreted virulence factor EspC, type VII ESX diderm |
2 | PF06259.14 | 1.0 | 2 | 1705.0 | same-strand | Alpha/beta hydrolase |
3 | PF16708.7 | 1.0 | 2 | 656 | same-strand | Lipoprotein confined to pathogenic Mycobacterium |
4 | PF01850.23 | 1.0 | 2 | 799.0 | same-strand | PIN domain |
5 | PF01402.23 | 1.0 | 2 | 530.0 | same-strand | Ribbon-helix-helix protein, copG family |