Result : P9WJ44
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB20 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 2866264 |
| Right | 2866509 |
| Strand | - |
| Nucleotide Sequence | ATGCTAGTGGCGTATATTTGCCATGTGAAAAGGCTGCAGATCTACATCGACGAAGACGTTGACCGAGCGCTTGCTGTTGAAGCGCGACGGCGGCGGACGTCGAAGGCGGCGCTGATCCGGGAGTACGTCGCTGAGCACCTCCGGCAGCCGGGCCCAGATCCGGTCGATGCCTTCGTCGGATCGTTCGTGGGGGAAGCCGACTTGTCCGCGTCCGTCGACGACGTGGTTTACGGAAAGCACGAATGA |
| Sequence | MLVAYICHVKRLQIYIDEDVDRALAVEARRRRTSKAALIREYVAEHLRQPGPDPVDAFVGSFVGEADLSASVDDVVYGKHE |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of cognate toxin VapC20. {ECO:0000250|UniProtKB:P9WJ45}. |
| Pubmed ID | 12218036 |
| Domain | CDD:419885 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P9WJ44 |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2870119 | 2870364 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2939806 | 2940051 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 1.0 | 2 | 882.0 | opposite-strand | PIN domain |
| 2 | PF01402.23 | 1.0 | 2 | 1256.0 | opposite-strand | Ribbon-helix-helix protein, copG family |
| 3 | PF01478.20 | 1.0 | 2 | 411.0 | same-strand | Type IV leader peptidase family |
| 4 | PF08501.13 | 1.0 | 2 | 842.0 | same-strand | Shikimate dehydrogenase substrate binding domain |
| 5 | PF18317.3 | 1.0 | 2 | 842.0 | same-strand | Shikimate 5'-dehydrogenase C-terminal domain |
| 6 | PF02618.18 | 1.0 | 2 | 1648.0 | same-strand | YceG-like family |
| 7 | PF03652.17 | 1.0 | 2 | 2894.0 | same-strand | Holliday junction resolvase |
| 8 | PF01411.21 | 1.0 | 2 | 3407.0 | same-strand | tRNA synthetases class II (A) |
| 9 | PF02272.21 | 1.0 | 2 | 3407.0 | same-strand | DHHA1 domain |
| 10 | PF07973.16 | 1.0 | 2 | 3407.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
++ More..