Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin VapB21 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 3070583 |
Right | 3070849 |
Strand | - |
Nucleotide Sequence | ATGCATCGCGGATATGCATTAGTAGTATGCTCTCCGGGTGTGACGCGCACCATGATCGACATCGATGACGACCTGCTCGCTCGGGCCGCCAAGGAACTGGGTACCACGACAAAGAAAGACACCGTGCATGCCGCGCTGCGGGCCGCGTTGCGAGCCAGTGCCGCGCGCTCGCTCATGAACCGGATGGCCGAGAACGCCACCGGAACCCAGGACGAAGCTCTGGTCAACGCAATGTGGCGAGACGGCCACCCAGAGAACACGGCATGA |
Sequence | MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWRDGHPENTA |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC21. {ECO:0000269|Pubmed:20011113, ECO:0000305|Pubmed:15718296}. |
Pubmed ID | 9634230 15718296 20011113 |
Domain | CDD:421349 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P9WJ43 |
ORF Length (Amino Acid) | 88 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3070583 | 3070849 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 3129813 | 3130079 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17770.3 | 1.0 | 2 | 4392.0 | same-strand | Ribonuclease J C-terminal domain |
2 | PF00753.29 | 1.0 | 2 | 4392.0 | same-strand | Metallo-beta-lactamase superfamily |
3 | PF00701.24 | 1.0 | 2 | 3459.0 | same-strand | Dihydrodipicolinate synthetase family |
4 | PF02511.17 | 1.0 | 2 | 2638.0 | same-strand | Thymidylate synthase complementing protein |
5 | PF02384.18 | 1.0 | 2 | 500.0 | same-strand | N-6 DNA Methylase |
6 | PF12161.10 | 1.0 | 2 | 500.0 | same-strand | HsdM N-terminal domain |
7 | PF01850.23 | 1.0 | 2 | 11.5 | same-strand | PIN domain |
8 | PF07704.13 | 1.0 | 2 | 418.0 | same-strand | Rv0623-like transcription factor |
9 | PF01420.21 | 1.0 | 2 | 697.0 | same-strand | Type I restriction modification DNA specificity domain |