Result : P9WJ43
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB21 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3070583 |
| Right | 3070849 |
| Strand | - |
| Nucleotide Sequence | ATGCATCGCGGATATGCATTAGTAGTATGCTCTCCGGGTGTGACGCGCACCATGATCGACATCGATGACGACCTGCTCGCTCGGGCCGCCAAGGAACTGGGTACCACGACAAAGAAAGACACCGTGCATGCCGCGCTGCGGGCCGCGTTGCGAGCCAGTGCCGCGCGCTCGCTCATGAACCGGATGGCCGAGAACGCCACCGGAACCCAGGACGAAGCTCTGGTCAACGCAATGTGGCGAGACGGCCACCCAGAGAACACGGCATGA |
| Sequence | MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWRDGHPENTA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC21. {ECO:0000269|Pubmed:20011113, ECO:0000305|Pubmed:15718296}. |
| Pubmed ID | 9634230 15718296 20011113 |
| Domain | CDD:421349 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ43 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3070583 | 3070849 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3129813 | 3130079 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17770.3 | 1.0 | 2 | 4392.0 | same-strand | Ribonuclease J C-terminal domain |
| 2 | PF00753.29 | 1.0 | 2 | 4392.0 | same-strand | Metallo-beta-lactamase superfamily |
| 3 | PF00701.24 | 1.0 | 2 | 3459.0 | same-strand | Dihydrodipicolinate synthetase family |
| 4 | PF02511.17 | 1.0 | 2 | 2638.0 | same-strand | Thymidylate synthase complementing protein |
| 5 | PF02384.18 | 1.0 | 2 | 500.0 | same-strand | N-6 DNA Methylase |
| 6 | PF12161.10 | 1.0 | 2 | 500.0 | same-strand | HsdM N-terminal domain |
| 7 | PF01850.23 | 1.0 | 2 | 11.5 | same-strand | PIN domain |
| 8 | PF07704.13 | 1.0 | 2 | 418.0 | same-strand | Rv0623-like transcription factor |
| 9 | PF01420.21 | 1.0 | 2 | 697.0 | same-strand | Type I restriction modification DNA specificity domain |
++ More..