| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB24 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 289218 |
| Right | 289451 |
| Strand | + |
| Nucleotide Sequence | ATGATTCGAACGCAAGTCCAGCTCCCAGATGAGCTTTACCGGGACGCCAAGCGGGTCGCGCACGAGCACGAAATGACCCTTGCCGAGGTCGTTCGTCGCGGGCTGGAGCACATGGTGCGGATCTATCCGAGGCGCGATGCGGCGTCCGACACCTGGCAGCCGCCCACGCCGCGTCGACTCGGTCCGTTTCGTGCGTCCGAAGAAACGTGGCGCGAGCTCGCCAACGAGGCGTGA |
| Sequence | MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRRDAASDTWQPPTPRRLGPFRASEETWRELANEA |
| Source of smORF | Swiss-Prot |
| Function | Possibly the antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC24 (Potential). {ECO:0000305}. |
| Pubmed ID | 12218036 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ40 |
| ORF Length (Amino Acid) | 77 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 289104 | 289337 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 295862 | 296095 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1683756 | 1683989 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 4 | 2241283 | 2241516 | - | NZ_AP022606.1 | Mycobacterium branderi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 1.0 | 4 | 8.0 | same-strand | PIN domain |