Result : P9WJ37
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB29 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 710782 |
| Right | 711009 |
| Strand | + |
| Nucleotide Sequence | GTGCGCACTACCATCGACCTGCCGCAAGACCTGCACAAGCAGGCACTGGCGATTGCCCGGGATACGCACCGCACGTTGAGTGAAACGGTCGCCGACCTCATGCGACGAGGCCTGGCCGCCAACCGCCCTACCGCGTTGTCCTCAGACCCCAGAACGGGATTGCCTTTGGTGAGCGTCGGGACCGTCGTGACCTCCGAGGACGTGCGTTCATTAGAGGACGAGCAGTGA |
| Sequence | MRTTIDLPQDLHKQALAIARDTHRTLSETVADLMRRGLAANRPTALSSDPRTGLPLVSVGTVVTSEDVRSLEDEQ |
| Source of smORF | Swiss-Prot |
| Function | Possibly the antitoxic component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC29. {ECO:0000305|Pubmed:20011113}. |
| Pubmed ID | 9634230 20011113 21969609 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ37 |
| ORF Length (Amino Acid) | 75 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 710782 | 711009 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 722544 | 722771 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3088017 | 3088244 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 4074320 | 4074547 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 5 | 1287759 | 1287974 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 6 | 4212462 | 4212689 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 7 | 1126318 | 1126545 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 8 | 3550336 | 3550566 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 9 | 2934891 | 2935121 | - | NZ_CP047156.1 | Epidermidibacterium keratini |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.89 | 8 | -3 | same-strand | PIN domain |
++ More..