Result : P9WJ34
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB30 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 717856 |
| Right | 718110 |
| Strand | + |
| Nucleotide Sequence | ATGGCGCTGAGTATCAAGCACCCGGAAGCCGACCGGCTCGCGCGAGCGCTTGCGGCGCGCACCGGCGAGACGTTGACCGAGGCAGTGGTTACCGCGTTGCGCGAGCGGCTCGCTCGTGAGACTGGGCGTGCCCGTGTTGTCCCGTTGCGCGACGAGCTTGCCGCGATTCGGCACCGGTGCGCAGCGTTGCCGGTGGTCGACAACCGGTCCGCTGAGGCGATTCTCGGCTATGACGAGCGCGGATTGCCGGCCTGA |
| Sequence | MALSIKHPEADRLARALAARTGETLTEAVVTALRERLARETGRARVVPLRDELAAIRHRCAALPVVDNRSAEAILGYDERGLPA |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | CDD:413087 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P9WJ34 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 33
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 716410 | 716664 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1967711 | 1967917 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 1436358 | 1436612 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 4 | 1758899 | 1759153 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 5 | 760227 | 760481 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 6 | 1889233 | 1889487 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 7 | 2200940 | 2201200 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 8 | 2001969 | 2002175 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 9 | 254312 | 254566 | - | NZ_CP032695.1 | Rhizobium jaguaris |
| 10 | 27624 | 27878 | - | NC_011892.1 | Methylobacterium nodulans ORS 2060 |
| 11 | 237833 | 238087 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 12 | 2311026 | 2311280 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 13 | 32627 | 32881 | - | NC_007961.1 | Nitrobacter hamburgensis X14 |
| 14 | 12339 | 12587 | + | NC_019765.1 | Stanieria cyanosphaera PCC 7437 |
| 15 | 883332 | 883586 | - | NC_020528.1 | Sinorhizobium meliloti 2011 |
| 16 | 5730703 | 5730957 | - | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 17 | 937528 | 937782 | - | NZ_CP034910.1 | Ensifer alkalisoli |
| 18 | 7137 | 7391 | - | NZ_CP013108.1 | Sinorhizobium americanum |
| 19 | 1339181 | 1339435 | + | NZ_CP041241.1 | Ensifer mexicanus |
| 20 | 106997 | 107251 | - | NZ_LT960615.1 | Hartmannibacter diazotrophicus |
| 21 | 2521720 | 2521974 | - | NZ_CP014989.1 | Serinicoccus hydrothermalis |
| 22 | 194348 | 194599 | + | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 23 | 339353 | 339607 | - | NZ_CP015882.1 | Ensifer adhaerens |
| 24 | 3203874 | 3204128 | - | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 25 | 2317402 | 2317653 | - | NZ_CP017147.1 | Bosea vaviloviae |
| 26 | 1886107 | 1886361 | - | NZ_CP030265.1 | Skermanella pratensis |
| 27 | 860579 | 860830 | - | NZ_CP025198.1 | Acidipropionibacterium virtanenii |
| 28 | 517033 | 517287 | - | NZ_CP064760.1 | Microbacterium schleiferi |
| 29 | 1384421 | 1384672 | + | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 30 | 440347 | 440601 | + | NC_019940.1 | Thioflavicoccus mobilis 8321 |
| 31 | 705464 | 705718 | + | NC_015635.1 | Microlunatus phosphovorus NM-1 |
| 32 | 890989 | 891246 | + | NZ_CP053923.1 | Defluviicoccus vanus |
| 33 | 672567 | 672815 | - | NZ_HG938354.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 34 | 6094 | 6357 | + | NZ_CP049241.1 | Rhizobium pseudoryzae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.91 | 30 | 0.0 | same-strand | PIN domain |
++ More..