Result : P9WJ27
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB37 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2364527 |
| Right | 2364781 |
| Strand | - |
| Nucleotide Sequence | ATGCGGACGACTGTCACATTGGATGACGACGTCGAGCAGTTGGTAAGGCGCCGGATGGCCGAGCGGCAAGTGTCCTTCAAGAAGGCCCTCAACGACGCGATTCGCGACGGCGCCTCCGGGCGACCTGCGCCGAGTCACTTCAGCACCCGCACGGCAGACTTGGGCGTCCCTGCGGTCAACCTCGACCGGGCCTTGCAGCTTGCGGCCGACCTCGAGGACGAAGAGCTTGTGCGCCGTCAACGCCGCGGGTCATAG |
| Sequence | MRTTVTLDDDVEQLVRRRMAERQVSFKKALNDAIRDGASGRPAPSHFSTRTADLGVPAVNLDRALQLAADLEDEELVRRQRRGS |
| Source of smORF | Swiss-Prot |
| Function | Probable antitoxin component of a type II toxin-antitoxin (TA) system. Its putative cognate toxin is VapC37. {ECO:0000305|Pubmed:20011113}. |
| Pubmed ID | 9634230 20011113 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ27 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2364527 | 2364781 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2419806 | 2420060 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1318088 | 1318342 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 4 | 2234027 | 2234281 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 5 | 76318 | 76569 | - | NZ_AP022562.1 | Mycobacterium novum |
| 6 | 1950637 | 1950888 | + | NC_015576.1 | Mycolicibacter sinensis |
| 7 | 5317131 | 5317385 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 8 | 1906071 | 1906325 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 9 | 106262 | 106516 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 10 | 2661758 | 2662012 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 11 | 5540046 | 5540300 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 12 | 3556569 | 3556823 | - | NZ_CP014989.1 | Serinicoccus hydrothermalis |
| 13 | 3433416 | 3433667 | + | NZ_CP047156.1 | Epidermidibacterium keratini |
| 14 | 419267 | 419515 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 15 | 2406573 | 2406830 | + | NZ_CP035494.1 | Microbacterium protaetiae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.93 | 14 | -3.0 | same-strand | PIN domain |
++ More..