Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin VapB39 |
NCBI Accession ID | AE000516.2 |
Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
Left | 2850170 |
Right | 2850394 |
Strand | - |
Nucleotide Sequence | ATGCGCACCACGTTGCAGATTGATGATGATGTTCTAGAAGATGCTCGTAGCATCGCGCGGTCGGAGGGCAAGTCAGTCGGCGCGGTAATTTCTGAGTTGGCGCGTAGGTCGCTCCGTCCGGTTGGGATTGTCGAGGTTGACGGATTTCCGGTTTTTGATGTTCCGCCGGATGCGCCGACGGTGACTTCCGAGGATGTCGTCCGCGCGCTCGAGGACGACGTGTGA |
Sequence | MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. {ECO:0000250}. |
Pubmed ID | 12218036 |
Domain | |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P9WJ22 |
ORF Length (Amino Acid) | 74 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2854683 | 2854907 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 2808083 | 2808304 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
3 | 2923775 | 2923999 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
4 | 2876144 | 2876365 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
5 | 2089224 | 2089448 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
6 | 2506911 | 2507132 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
7 | 1272311 | 1272535 | + | NZ_AP022581.1 | Mycobacterium lacus |
8 | 3608719 | 3608943 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
9 | 2391579 | 2391800 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
10 | 912253 | 912480 | - | NZ_CP029452.1 | Sinorhizobium fredii CCBAU 25509 |
11 | 929832 | 930059 | + | NZ_CP020911.1 | Rhizobium etli |
12 | 427135 | 427362 | - | NC_020560.1 | Sinorhizobium meliloti 2011 |
13 | 631693 | 631920 | - | NZ_CP050299.1 | Mesorhizobium huakuii |
14 | 2332348 | 2332575 | - | NZ_CP034909.1 | Ensifer alkalisoli |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.82 | 9 | -3.0 | same-strand | PIN domain |