Result : A6Q7I8
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | AP009179.1 |
| Organism | Sulfurovum sp. (strain NBC37-1) |
| Left | 494901 |
| Right | 495191 |
| Strand | - |
| Nucleotide Sequence | GTGCAGATAGACAACACTGTTTTGGAAAAACTCGAAAAACTCTCCCATCTTCGTATCGATGATTCAAAAAAAGAGGAAGTGATGGGTCAGCTGAGTGAAATACTCGGCTACATCGATAATCTCAACGAACTCAATACGGATCATCTCGATGCAGCCTTTTCGACACTGAAGGGAGGAACACCCTTGAGAGAGGACATCCCAAGAACAGAGAATAACATTGCCAGGGACATTCTCTCCCGTGCACCTGAAAGCAAAGATGACTTTTTCATTGTACCTGCGATTATCGAATAA |
| Sequence | MQIDNTVLEKLEKLSHLRIDDSKKEEVMGQLSEILGYIDNLNELNTDHLDAAFSTLKGGTPLREDIPRTENNIARDILSRAPESKDDFFIVPAIIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 17615243 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A6Q7I8 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1789020 | 1789310 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 2 | 1723732 | 1724022 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 3 | 1647292 | 1647582 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 4 | 565599 | 565889 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 5 | 1249544 | 1249834 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 6 | 724129 | 724419 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 7 | 752222 | 752512 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 8 | 1349670 | 1349960 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 9 | 2525660 | 2525950 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 10 | 2095023 | 2095313 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 11 | 1555212 | 1555499 | - | NZ_CP012541.1 | Campylobacter concisus |
| 12 | 1215773 | 1216063 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 13 | 358549 | 358833 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 14 | 108067 | 108345 | + | NZ_LN907858.1 | Helicobacter typhlonius |
| 15 | 1143442 | 1143729 | - | NZ_CP059443.1 | Campylobacter fetus |
| 16 | 519473 | 519760 | + | NZ_CP053826.1 | Campylobacter curvus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011308.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00437.22 | 0.81 | 13 | 28 | same-strand | Type II/IV secretion system protein |
| 2 | PF02674.18 | 0.69 | 11 | 1481 | same-strand | Colicin V production protein |
| 3 | PF01475.21 | 0.62 | 10 | 2106.0 | same-strand | Ferric uptake regulator family |
| 4 | PF00152.22 | 0.69 | 11 | 2651 | same-strand | tRNA synthetases class II (D, K and N) |
| 5 | PF01336.27 | 0.69 | 11 | 2651 | same-strand | OB-fold nucleic acid binding domain |
++ More..