Result : P9WJ20
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB41 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 2926214 |
| Right | 2926501 |
| Strand | + |
| Nucleotide Sequence | ATGAAGACCACGCTCGACCTGCCTGATGAACTGATGCGCGCTATCAAGGTCCGCGCGGCGCAGCAGGGCCGCAAGATGAAAGATGTCGTGACCGAACTGCTCAGATCCGGTCTGTCCCAGACGCACAGCGGGGCTCCAATCCCAACGCCGCGGCGCGTGCAGCTTCCCCTGGTGCATTGCGGTGGCGCGGCTACCCGCGAACAAGAAATGACGCCGGAGCGTGTTGCCGCGGCCTTGCTCGACCAGGAGGCCCAGTGGTGGTCCGGACACGACGATGCTGCTCTGTGA |
| Sequence | MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALLDQEAQWWSGHDDAAL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ20 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2930070 | 2930357 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2999765 | 3000052 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1185261 | 1185548 | - | NZ_AP022581.1 | Mycobacterium lacus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13785.8 | 0.67 | 2 | 3095.0 | same-strand | Domain of unknown function (DUF4178) |
| 2 | PF10936.10 | 0.67 | 2 | 2590.0 | same-strand | Protein of unknown function DUF2617 |
| 3 | PF14042.8 | 0.67 | 2 | 2162.0 | same-strand | Domain of unknown function (DUF4247) |
| 4 | PF03994.16 | 0.67 | 2 | 1679.0 | same-strand | Domain of Unknown Function (DUF350) |
| 5 | PF01564.19 | 0.67 | 2 | 111.0 | same-strand | Spermine/spermidine synthase domain |
| 6 | PF13649.8 | 0.67 | 2 | 111.0 | same-strand | Methyltransferase domain |
| 7 | PF01850.23 | 1.0 | 3 | -13 | same-strand | PIN domain |
| 8 | PF01709.22 | 0.67 | 2 | 448.0 | opposite-strand | Transcriptional regulator |
| 9 | PF01174.21 | 0.67 | 2 | 1336.0 | opposite-strand | SNO glutamine amidotransferase family |
| 10 | PF02551.17 | 0.67 | 2 | 1940.0 | opposite-strand | Acyl-CoA thioesterase |
| 11 | PF13622.8 | 0.67 | 2 | 1940.0 | opposite-strand | Thioesterase-like superfamily |
| 12 | PF01680.19 | 0.67 | 2 | 2814.0 | opposite-strand | SOR/SNZ family |
++ More..