Result : P9WJ17
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB44 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3708074 |
| Right | 3708316 |
| Strand | - |
| Nucleotide Sequence | ATGCGCACCACGTTGTCCATCGACGACGATGTATTGCTGGCCGTGAAGGAACGGGCACGCAGGGAGAAGCGCACCGCGGGTGAAATCCTGTCGGATCTGGCCCGGCAAGCGTTAACCAACCAGAATCCCCAGCCTGCGGCGAGCCAGGAGGACGCCTTTCATGGCTTCGAACCCCTGCCTCATCGCGGTGGAGCGGTATCGAACGCGCTGATCGATCGGCTTCGTGACGAGGAGGCCGTGTGA |
| Sequence | MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV |
| Source of smORF | Swiss-Prot |
| Function | Possibly the antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC44. {ECO:0000305|Pubmed:20011113}. |
| Pubmed ID | 9634230 20011113 |
| Domain | CDD:425357 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ17 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 12
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3708074 | 3708316 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 3772122 | 3772364 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 768473 | 768712 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 4998817 | 4999056 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 5 | 3872134 | 3872373 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 6 | 358111 | 358341 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 7 | 2068538 | 2068774 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 8 | 510036 | 510275 | + | NZ_CP022752.1 | Actinopolyspora erythraea |
| 9 | 1285373 | 1285621 | + | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 10 | 3446751 | 3447002 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 11 | 1309509 | 1309751 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 12 | 3700057 | 3700302 | + | NZ_CP059467.1 | Aromatoleum bremense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.75 | 9 | 0.0 | same-strand | PIN domain |
++ More..