Result : P9WJ15
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB48 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 4140239 |
| Right | 4140463 |
| Strand | - |
| Nucleotide Sequence | ATGCGCACTACGATCGACCTCGATGACGACATACTGCGGGCGTTGAAACGACGCCAGCGCGAGGAGCGCAAAACGTTAGGGCAGCTCGCCTCCGAATTGCTTGCGCAAGCTCTGGCGGCCGAGCCTCCTCCAAACGTTGACATCCGCTGGTCGACTGCCGACTTGCGGCCCCGTGTGGATCTTGACGACAAGGACGCTGTTTGGGCGATTTTGGACCGTGGGTGA |
| Sequence | MRTTIDLDDDILRALKRRQREERKTLGQLASELLAQALAAEPPPNVDIRWSTADLRPRVDLDDKDAVWAILDRG |
| Source of smORF | Swiss-Prot |
| Function | Possibly the antitoxin component of a type II toxin-antitoxin (TA) system. Its cognate toxin is VapC48. {ECO:0000305|Pubmed:20011113}. |
| Pubmed ID | 9634230 20011113 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ15 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4140239 | 4140463 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 4209813 | 4210037 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 4875438 | 4875662 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 4072777 | 4073001 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 5 | 1779570 | 1779791 | + | NZ_AP022606.1 | Mycobacterium branderi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022575.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01944.19 | 0.8 | 4 | 3480.5 | same-strand | Stage II sporulation protein M |
| 2 | PF06271.14 | 0.8 | 4 | 2453.5 | opposite-strand | RDD family |
| 3 | PF00370.23 | 1.0 | 5 | 484 | same-strand | FGGY family of carbohydrate kinases, N-terminal domain |
| 4 | PF02782.18 | 1.0 | 5 | 484 | same-strand | FGGY family of carbohydrate kinases, C-terminal domain |
| 5 | PF01850.23 | 1.0 | 5 | -3.0 | same-strand | PIN domain |
| 6 | PF13649.8 | 1.0 | 5 | 1581 | opposite-strand | Methyltransferase domain |
| 7 | PF08241.14 | 0.8 | 4 | 1573.5 | opposite-strand | Methyltransferase domain |
| 8 | PF08242.14 | 0.8 | 4 | 1573.5 | opposite-strand | Methyltransferase domain |
| 9 | PF00266.21 | 0.8 | 4 | 2285.0 | same-strand | Aminotransferase class-V |
| 10 | PF10017.11 | 0.8 | 4 | 3460.5 | same-strand | Histidine-specific methyltransferase, SAM-dependent |
| 11 | PF03551.16 | 0.6 | 3 | 2034 | opposite-strand | Transcriptional regulator PadR-like family |
++ More..