Result : P9WJ06
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin MT0933 |
| NCBI Accession ID | AE000516.2 |
| Organism | Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) |
| Left | 1014694 |
| Right | 1014873 |
| Strand | + |
| Nucleotide Sequence | ATGGGAATCCTGGACAAGGTAAAGAACCTGCTGTCGCAGAACGCCGACAAGGTCGAGACGGTGATCAACAAAGCGGGCGAATTCGTCGACGAGCAGACGCAAGGCAATTATTCTGACGCCATCCACAAGCTGCATGACGCGGCCAGCAACGTCGTCGGCATGAGCGACCAGCAGAGCTAG |
| Sequence | MGILDKVKNLLSQNADKVETVINKAGEFVDEQTQGNYSDAIHKLHDAASNVVGMSDQQS |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT0934 (By similarity). {ECO:0000250}. |
| Pubmed ID | 12218036 |
| Domain | CDD:404829 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WJ06 |
| ORF Length (Amino Acid) | 59 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1014681 | 1014860 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1019919 | 1020098 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 4619264 | 4619452 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 4 | 2142159 | 2142347 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 5 | 5198749 | 5198937 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 6 | 460693 | 460881 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 7 | 409505 | 409693 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 8 | 2095716 | 2095895 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 9 | 887596 | 887784 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 10 | 4643464 | 4643652 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 11 | 5694832 | 5695011 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 12 | 901383 | 901571 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 13 | 4931571 | 4931759 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 14 | 3338491 | 3338679 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 15 | 875874 | 876062 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 16 | 892983 | 893171 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 17 | 3179891 | 3180079 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 18 | 5561781 | 5561966 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 19 | 2699496 | 2699684 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 20 | 5732470 | 5732658 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 21 | 3508440 | 3508625 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 22 | 2413468 | 2413647 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 23 | 1283480 | 1283659 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 24 | 2655595 | 2655798 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 25 | 4705892 | 4706071 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 26 | 1516779 | 1516961 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 27 | 2393583 | 2393762 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 28 | 1078452 | 1078631 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 29 | 3210365 | 3210553 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 30 | 6084906 | 6085085 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 31 | 2498455 | 2498637 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 32 | 3655362 | 3655544 | - | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 33 | 783858 | 784022 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 34 | 3297548 | 3297754 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 35 | 899907 | 900113 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00378.22 | 0.89 | 31 | 5182 | same-strand | Enoyl-CoA hydratase/isomerase |
| 2 | PF12706.9 | 0.94 | 33 | 4068 | same-strand | Beta-lactamase superfamily domain |
| 3 | PF13483.8 | 0.94 | 33 | 4068 | same-strand | Beta-lactamase superfamily domain |
| 4 | PF00144.26 | 0.8 | 28 | 2450.0 | same-strand | Beta-lactamase |
| 5 | PF00122.22 | 0.91 | 32 | 67.5 | same-strand | E1-E2 ATPase |
| 6 | PF00702.28 | 0.91 | 32 | 67.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 7 | PF10604.11 | 1.0 | 35 | 5 | same-strand | Polyketide cyclase / dehydrase and lipid transport |
++ More..