Result : A6Q692
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L35 |
| NCBI Accession ID | AP009179.1 |
| Organism | Sulfurovum sp. (strain NBC37-1) |
| Left | 46040 |
| Right | 46231 |
| Strand | + |
| Nucleotide Sequence | ATGCCAAAAATGAAAAGCGTAAAAGGCGCTGTTAAGCGTTTTAAAGTGAAAAAAAGCGGCAAGATCAAAAGAGGGACTGCATATAGAAGTCACATTCTTACAAAAGTCGATGGTAAACACCATAGACAAATGAGAAGTTCCAAACATGTCGATACAGTAGATGCCAAAAACATCAAAGAGATGATCAACTAA |
| Sequence | MPKMKSVKGAVKRFKVKKSGKIKRGTAYRSHILTKVDGKHHRQMRSSKHVDTVDAKNIKEMIN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00392. Profile Description: Ribosomal protein L35. This ribosomal protein is found in bacteria and organelles only. It is not closely related to any eukaryotic or archaeal ribosomal protein. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 17615243 |
| Domain | CDD:412354 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A6Q692 |
| ORF Length (Amino Acid) | 63 |
++ More..
| Conservation Analysis |
No. of Species: 180
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2117211 | 2117402 | - | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 2 | 102658 | 102849 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 3 | 47757 | 47951 | - | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 4 | 2002014 | 2002208 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 5 | 1895792 | 1895986 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 6 | 1461720 | 1461917 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 7 | 210149 | 210340 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 8 | 371264 | 371458 | - | NC_012115.1 | Nautilia profundicola AmH |
| 9 | 1522152 | 1522349 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 10 | 106575 | 106769 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 11 | 381375 | 381569 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 12 | 211296 | 211493 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 13 | 246363 | 246560 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 14 | 263743 | 263940 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 15 | 207205 | 207399 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 16 | 195416 | 195613 | - | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 17 | 238849 | 239046 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 18 | 209958 | 210155 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 19 | 221673 | 221870 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 20 | 85429 | 85626 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 21 | 173825 | 174022 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 22 | 180202 | 180399 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 23 | 297204 | 297398 | - | NZ_CP053836.1 | Halarcobacter ebronensis |
| 24 | 97383 | 97574 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 25 | 25621 | 25812 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 26 | 289681 | 289878 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 27 | 250254 | 250451 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 28 | 1975074 | 1975265 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 29 | 292819 | 293013 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 30 | 238230 | 238427 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 31 | 644290 | 644487 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 32 | 245775 | 245972 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 33 | 201320 | 201517 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 34 | 93688 | 93879 | - | NZ_CP059443.1 | Campylobacter fetus |
| 35 | 120024 | 120215 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 36 | 1522857 | 1523054 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 37 | 198646 | 198843 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 38 | 165404 | 165601 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 39 | 222580 | 222777 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 40 | 1796114 | 1796311 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 41 | 1460620 | 1460811 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 42 | 2111557 | 2111754 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 43 | 34866 | 35057 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 44 | 37745 | 37936 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 45 | 1574277 | 1574468 | - | NZ_CP053825.1 | Campylobacter armoricus |
| 46 | 36556 | 36747 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 47 | 673238 | 673429 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 48 | 36800 | 36991 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 49 | 526770 | 526964 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 50 | 154249 | 154446 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 51 | 2095064 | 2095261 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 52 | 124010 | 124201 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 53 | 45773 | 45967 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 54 | 34788 | 34979 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 55 | 844915 | 845106 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 56 | 27323 | 27514 | + | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 57 | 1744453 | 1744644 | - | NZ_CP020478.1 | Campylobacter helveticus |
| 58 | 226116 | 226307 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 59 | 810951 | 811148 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 60 | 1654253 | 1654450 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 61 | 2427264 | 2427455 | - | NZ_CP012543.1 | Campylobacter rectus |
| 62 | 60718 | 60909 | - | NZ_CP012544.1 | Campylobacter showae |
| 63 | 2385893 | 2386090 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 64 | 1695920 | 1696111 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 65 | 1581910 | 1582107 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 66 | 1936047 | 1936244 | + | NZ_HG916765.1 | Castellaniella defragrans 65Phen |
| 67 | 1517243 | 1517440 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 68 | 1535537 | 1535734 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 69 | 9952 | 10146 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 70 | 1069903 | 1070100 | + | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 71 | 2069301 | 2069495 | - | NC_014624.2 | Eubacterium callanderi |
| 72 | 706220 | 706414 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 73 | 3805964 | 3806158 | - | NZ_CP019962.1 | Eubacterium limosum |
| 74 | 1591668 | 1591865 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 75 | 125320 | 125511 | - | NZ_CP012541.1 | Campylobacter concisus |
| 76 | 1564191 | 1564385 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 77 | 71510 | 71701 | - | NZ_CP053826.1 | Campylobacter curvus |
| 78 | 1720433 | 1720624 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 79 | 2011687 | 2011884 | - | NZ_CP012154.1 | Wenzhouxiangella marina |
| 80 | 3184912 | 3185109 | + | NZ_CP034413.2 | Dysosmobacter welbionis |
| 81 | 95924 | 96118 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 82 | 2649454 | 2649648 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 83 | 82362 | 82556 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 84 | 1071952 | 1072149 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 85 | 1688880 | 1689077 | + | NZ_CP010311.1 | Geoalkalibacter subterraneus |
| 86 | 133610 | 133804 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 87 | 136109 | 136303 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 88 | 3167593 | 3167787 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 89 | 1097758 | 1097955 | + | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 90 | 1801048 | 1801245 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 91 | 2610008 | 2610205 | + | NC_018518.1 | Bordetella pertussis 18323 |
| 92 | 2108984 | 2109181 | + | NZ_AP019378.1 | Bordetella parapertussis |
| 93 | 1842958 | 1843155 | + | NZ_LR134326.1 | Bordetella bronchiseptica |
| 94 | 704834 | 705031 | + | NC_016043.1 | Taylorella asinigenitalis MCE3 |
| 95 | 74509 | 74703 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 96 | 1664628 | 1664825 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 97 | 151016 | 151213 | - | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 98 | 985772 | 985969 | + | NZ_CP029331.1 | Thauera hydrothermalis |
| 99 | 2551309 | 2551506 | - | NZ_CP043146.1 | Bordetella holmesii |
| 100 | 1773793 | 1773990 | + | NZ_CP016440.1 | Bordetella pseudohinzii |
| 101 | 288091 | 288288 | + | NZ_CP047165.1 | Pelistega ratti |
| 102 | 3788900 | 3789097 | - | NZ_CP016172.1 | Bordetella flabilis |
| 103 | 1782707 | 1782907 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 104 | 3208208 | 3208405 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 105 | 728029 | 728226 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 106 | 2209289 | 2209486 | - | NC_010645.1 | Bordetella avium 197N |
| 107 | 1888008 | 1888205 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 108 | 1587444 | 1587641 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 109 | 1287840 | 1288037 | + | NZ_CP028339.1 | Thauera aromatica K172 |
| 110 | 2521945 | 2522142 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 111 | 3540820 | 3541017 | + | NZ_CP021395.1 | Bordetella hinzii |
| 112 | 2191329 | 2191526 | + | NZ_CP016171.1 | Bordetella bronchialis |
| 113 | 2233088 | 2233285 | + | NZ_CP018839.1 | Thauera chlorobenzoica |
| 114 | 2746606 | 2746803 | - | NZ_LT907988.1 | Orrella dioscoreae |
| 115 | 2765213 | 2765410 | - | NC_010170.1 | Bordetella petrii |
| 116 | 538841 | 539038 | - | NZ_LR134302.1 | Achromobacter spanius |
| 117 | 4236098 | 4236295 | - | NZ_CP038034.1 | Achromobacter insolitus |
| 118 | 548573 | 548770 | + | NZ_CP053986.1 | Achromobacter denitrificans |
| 119 | 2121475 | 2121672 | + | NZ_CP043046.1 | Pigmentiphaga aceris |
| 120 | 36869 | 37063 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 121 | 508784 | 508981 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 122 | 3126420 | 3126617 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 123 | 1083486 | 1083683 | + | NZ_CP028901.1 | Algicoccus marinus |
| 124 | 1710431 | 1710613 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 125 | 194765 | 194962 | + | NZ_CP014646.1 | Thauera humireducens |
| 126 | 3982954 | 3983151 | - | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 127 | 3981665 | 3981862 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 128 | 1992799 | 1992996 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 129 | 1385487 | 1385684 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 130 | 1188169 | 1188366 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 131 | 2400602 | 2400796 | - | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 132 | 2328034 | 2328231 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 133 | 2196274 | 2196471 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 134 | 339881 | 340078 | - | NZ_LR134441.1 | Kaistella antarctica |
| 135 | 289765 | 289962 | - | NZ_CP034159.1 | Kaistella carnis |
| 136 | 858220 | 858417 | + | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 137 | 1476110 | 1476307 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 138 | 1074522 | 1074716 | + | NZ_CP009687.1 | Clostridium aceticum |
| 139 | 1278570 | 1278764 | + | NZ_CP020559.1 | Clostridium formicaceticum |
| 140 | 1722512 | 1722703 | + | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 141 | 2485101 | 2485301 | - | NZ_LT906451.1 | Legionella lansingensis |
| 142 | 2150941 | 2151135 | - | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 143 | 482963 | 483157 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 144 | 1247113 | 1247310 | + | NZ_CP016210.1 | Azoarcus olearius |
| 145 | 530780 | 530977 | - | NZ_CP034930.1 | Apibacter raozihei |
| 146 | 1315984 | 1316181 | + | NZ_CP025682.1 | Azoarcus pumilus |
| 147 | 172075 | 172269 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 148 | 2362608 | 2362811 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 149 | 1486056 | 1486253 | + | NZ_CP015067.2 | Elizabethkingia anophelis |
| 150 | 1086800 | 1086997 | - | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 151 | 2380823 | 2381017 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 152 | 266479 | 266676 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 153 | 1480201 | 1480398 | + | NC_013204.1 | Eggerthella lenta DSM 2243 |
| 154 | 417879 | 418073 | + | NZ_CP011005.1 | Psychromicrobium lacuslunae |
| 155 | 1412388 | 1412585 | - | NZ_CP029556.1 | Lysobacter oculi |
| 156 | 1477769 | 1477966 | + | NC_017857.3 | Methylophaga nitratireducenticrescens |
| 157 | 1999744 | 1999941 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 158 | 2116044 | 2116241 | - | NZ_CP017253.2 | Clostridium taeniosporum |
| 159 | 1064635 | 1064832 | + | NZ_CP011402.1 | Denitrobacterium detoxificans |
| 160 | 588735 | 588932 | + | NZ_CP017774.1 | Flavobacterium commune |
| 161 | 29671 | 29868 | + | NZ_CP029255.1 | Flavobacterium crocinum |
| 162 | 20081 | 20278 | + | NZ_CP054494.1 | Flavobacterium columnare |
| 163 | 1783866 | 1784063 | - | NZ_CP038810.1 | Flavobacterium sangjuense |
| 164 | 4512744 | 4512938 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 165 | 3633807 | 3634004 | - | NZ_CP037933.1 | Flavobacterium nackdongense |
| 166 | 4056735 | 4056932 | + | NZ_CP020919.1 | Flavobacterium kingsejongi |
| 167 | 32999 | 33196 | + | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 168 | 2005083 | 2005280 | - | NZ_CP029187.1 | Flavobacterium pallidum |
| 169 | 1883416 | 1883613 | - | NZ_CP028811.1 | Flavobacterium magnum |
| 170 | 489753 | 489950 | + | NZ_LT615228.1 | Polynucleobacter necessarius |
| 171 | 1354185 | 1354382 | - | NZ_CP017688.1 | Flavobacterium crassostreae |
| 172 | 2505571 | 2505768 | - | NZ_CP020918.1 | Flavobacterium faecale |
| 173 | 3664965 | 3665162 | + | NZ_CP030356.1 | Salinibacter ruber |
| 174 | 171073 | 171267 | - | NC_010803.1 | Chlorobium limicola DSM 245 |
| 175 | 444301 | 444498 | + | NZ_CP031188.1 | Flavobacterium arcticum |
| 176 | 899212 | 899409 | - | NZ_CP030086.1 | Polynucleobacter paneuropaeus |
| 177 | 819417 | 819614 | + | NZ_CP023276.1 | Polynucleobacter difficilis |
| 178 | 826035 | 826232 | + | NC_009379.1 | Polynucleobacter asymbioticus QLW-P1DMWA-1 |
| 179 | 724169 | 724324 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 180 | 5318690 | 5318887 | - | NZ_CP019288.1 | Kordia antarctica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP063164.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00453.20 | 1.0 | 180 | 87.0 | same-strand | Ribosomal protein L20 |
| 2 | PF00587.27 | 0.63 | 114 | 681.0 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 3 | PF03129.22 | 0.63 | 114 | 681.0 | same-strand | Anticodon binding domain |
| 4 | PF07973.16 | 0.63 | 114 | 681.0 | same-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 5 | PF00707.24 | 0.73 | 131 | 115 | same-strand | Translation initiation factor IF-3, C-terminal domain |
++ More..