Result : P9WHG7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Toxin ParE1 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 2203681 |
| Right | 2203977 |
| Strand | - |
| Nucleotide Sequence | GTGAGTAGCCGATACCTTCTCTCGCCTGCCGCGCAGGCACATCTGGAAGAGATCTGGGACTGCACCTATGACCGTTGGGGTGTCGATCAGGCCGAGCAGTACCTGCGCGAACTTCAACACGCTATCGACCGTGCTGCGGCAAACCCGCGGATCGGACGAGCGTGCGACGAGATTCGCCCCGGCTATCGCAAGCTCTCGGCCGGGTCACACACGTTGTTCTATCGGGTGACTGGCGAAGGCACCATCGACGTCGTGCGAGTCCTGCACCAACGGATGGACGTCGACCGGAACCTCTGA |
| Sequence | MSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEGTIDVVRVLHQRMDVDRNL |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli inhibits cell growth and colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin ParD1. {ECO:0000269|Pubmed:19016878}. |
| Pubmed ID | 9634230 15718296 19016878 21969609 |
| Domain | CDD:419697 |
| Functional Category | Toxin_type_2 |
| Uniprot ID | P9WHG7 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2203681 | 2203977 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2247691 | 2247987 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 90261 | 90515 | - | NC_022654.1 | Mycobacterium kansasii ATCC 12478 |
| 4 | 2117765 | 2118061 | - | NZ_AP022562.1 | Mycobacterium novum |
| 5 | 2702246 | 2702542 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 6 | 1851732 | 1852028 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 7 | 4749376 | 4749633 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 8 | 1340061 | 1340354 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 9 | 3804428 | 3804709 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 10 | 3557639 | 3557926 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 11 | 771747 | 772049 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 12 | 254069 | 254320 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 13 | 162 | 452 | + | NZ_CP066060.1 | Actinomyces oris |
| 14 | 2016351 | 2016641 | - | NZ_CP060789.1 | Tessaracoccus defluvii |
| 15 | 2171479 | 2171769 | + | NZ_CP035806.1 | Leucobacter triazinivorans |
| 16 | 158013 | 158303 | - | NZ_CP049934.1 | Leucobacter insecticola |
| 17 | 3467186 | 3467485 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 18 | 1355672 | 1355971 | + | NZ_CP009831.1 | Burkholderia multivorans ATCC BAA-247 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03693.16 | 0.83 | 15 | -3 | same-strand | Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH |
++ More..