Result : P9WHB1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28-1 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 123980 |
| Right | 124264 |
| Strand | - |
| Nucleotide Sequence | ATGTCCGCCCGCTGCCAAATCACCGGCCGCACTGTGGGTTTCGGTAAGGCTGTGTCGCACTCACACCGCCGCACTCGGCGACGTTGGCCGCCCAATATCCAGCTCAAGGCCTACTACTTACCGTCGGAGGACCGCCGCATCAAGGTGCGGGTCAGCGCCCAAGGAATCAAGGTCATCGACCGCGACGGGCATCGAGGCCGTCGTCGCGCGGCTCGGGCAGGATCCGCCCCGGCGCACTTCGCGCGCCAAGCGGGCTCATCGCTCCGAACGGCGGCGATCCTGTGA |
| Sequence | MSARCQITGRTVGFGKAVSHSHRRTRRRWPPNIQLKAYYLPSEDRRIKVRVSAQGIKVIDRDGHRGRRRAARAGSAPAHFARQAGSSLRTAAIL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 9634230 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | P9WHB1 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 123980 | 124264 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 127543 | 127827 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00550.27 | 1.0 | 2 | 10201.0 | opposite-strand | Phosphopantetheine attachment site |
| 2 | PF00501.30 | 1.0 | 2 | 6441.0 | opposite-strand | AMP-binding enzyme |
| 3 | PF00668.22 | 1.0 | 2 | 6441.0 | opposite-strand | Condensation domain |
| 4 | PF07993.14 | 1.0 | 2 | 6441.0 | opposite-strand | Male sterility protein |
| 5 | PF13193.8 | 1.0 | 2 | 6441.0 | opposite-strand | AMP-binding enzyme C-terminal domain |
| 6 | PF09678.12 | 1.0 | 2 | 4281.0 | opposite-strand | Cytochrome c oxidase caa3 assembly factor (Caa3 CtaG) |
| 7 | PF05425.15 | 1.0 | 2 | 4281.0 | opposite-strand | Copper resistance protein D |
| 8 | PF00702.28 | 1.0 | 2 | 1603.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 9 | PF00122.22 | 1.0 | 2 | 1603.5 | same-strand | E1-E2 ATPase |
| 10 | PF00403.28 | 1.0 | 2 | 1807.0 | same-strand | Heavy-metal-associated domain |
| 11 | PF00027.31 | 1.0 | 2 | 149.0 | opposite-strand | Cyclic nucleotide-binding domain |
| 12 | PF07683.16 | 1.0 | 2 | 109.5 | opposite-strand | Cobalamin synthesis protein cobW C-terminal domain |
| 13 | PF00689.23 | 1.0 | 2 | 1389.5 | same-strand | Cation transporting ATPase, C-terminus |
| 14 | PF00934.22 | 1.0 | 2 | 7118.5 | opposite-strand | PE family |
| 15 | PF01694.24 | 1.0 | 2 | 8756.5 | opposite-strand | Rhomboid family |
++ More..