Result : P9WF71
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative ribonuclease VapC34 (Putative RNase VapC34) (EC 3.1.-.-) (Toxin VapC34) |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 1967917 |
| Right | 1968165 |
| Strand | + |
| Nucleotide Sequence | ATGGTGATCGATACCTCTGCGCTGGTCGCGATGCTCAACGATGAACCCGAGGCGCAACGGTTCGAGATAGCCGTGGCAGCAGACCACGTTTGGCTGATGTCGACGGCGTCATATCCGGAGATGGCGACCGTGATCGAAACACGCTTCGGGGAACCGGGGGGACGTGAACCCAAGGTCAGCGGCCAGCCTCTCCTCTATAAGGGTGACGATTTCGCATGTATCGATATTCGCGCGGTTCTCGCCGGCTGA |
| Sequence | MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYKGDDFACIDIRAVLAG |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a possible type II toxin-antitoxin (TA) system. A putative RNase. Its cognate antitoxin is VapB34 (By similarity). {ECO:0000250}. |
| Pubmed ID | 9634230 20011113 |
| Domain | CDD:421694 |
| Functional Category | Metal-binding_and_Toxin_type_2 |
| Uniprot ID | P9WF71 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2002175 | 2002423 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 1967917 | 1968165 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07690.18 | 1.0 | 2 | 2547.0 | opposite-strand | Major Facilitator Superfamily |
| 2 | PF08962.13 | 1.0 | 2 | 1976.0 | same-strand | Domain of unknown function (DUF1876) |
| 3 | PF00916.22 | 1.0 | 2 | 292.0 | opposite-strand | Sulfate permease family |
| 4 | PF01740.23 | 1.0 | 2 | 292.0 | opposite-strand | STAS domain |
| 5 | PF00069.27 | 1.0 | 2 | 839.0 | same-strand | Protein kinase domain |
| 6 | PF07714.19 | 1.0 | 2 | 2406.0 | same-strand | Protein tyrosine and serine/threonine kinase |
| 7 | PF13462.8 | 1.0 | 2 | 839.0 | same-strand | Thioredoxin |
| 8 | PF00293.30 | 1.0 | 2 | 3215.0 | opposite-strand | NUDIX domain |
++ More..