Result : P9WF25
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin RelJ (Antitoxin YefM) |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 3770773 |
| Right | 3771048 |
| Strand | + |
| Nucleotide Sequence | ATGAGCATCAGTGCGAGCGAGGCGAGGCAGCGCCTGTTTCCACTCATCGAACAGGTCAATACCGATCACCAGCCGGTGCGGATCACCTCCCGGGCCGGCGATGCGGTGCTGATGTCCGCCGACGACTACGACGCGTGGCAGGAAACGGTCTATCTGCTGCGCTCACCGGAGAACGCCAGGCGGTTGATGGAAGCGGTTGCCCGGGATAAGGCTGGGCACTCGGCTTTCACCAAGTCTGTAGATGAGCTGCGGGAGATGGCCGGCGGCGAGGAGTGA |
| Sequence | MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. A probable antitoxin for the putative mRNA interferase RelK. Upon expression in E.coli but not in M.smegmatis this protein neutralizes E.coli YoeB.; Binds to and represses its own promoter, in combination with RelK repression is somewhat lessened. Several DNA-protein complexes are formed in vitro depending on the RelJ:RelK ratio. |
| Pubmed ID | 9634230 19114484 20011113 20498855 21969609 18793646 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2_and_DNA-binding |
| Uniprot ID | P9WF25 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 30
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3840484 | 3840759 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 3770773 | 3771048 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 4114872 | 4115147 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 4 | 3712145 | 3712420 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 5 | 2211209 | 2211484 | + | NZ_CP063373.1 | Streptomyces ferrugineus |
| 6 | 105204 | 105488 | + | NC_022654.1 | Mycobacterium kansasii ATCC 12478 |
| 7 | 2711026 | 2711301 | - | NZ_CP009922.3 | Streptomyces xiamenensis |
| 8 | 3795558 | 3795833 | + | NZ_CP071139.1 | Streptomyces nojiriensis |
| 9 | 2433572 | 2433856 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 10 | 355119 | 355397 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 11 | 2438067 | 2438339 | - | NZ_CP032229.1 | Streptomyces seoulensis |
| 12 | 6037757 | 6038029 | + | NZ_CP030862.1 | Streptomyces globosus |
| 13 | 6502166 | 6502438 | - | NZ_CP045643.1 | Streptomyces fagopyri |
| 14 | 5231244 | 5231516 | - | NZ_CP034279.1 | Streptomyces ficellus |
| 15 | 5598531 | 5598794 | - | NZ_LN831790.1 | Streptomyces leeuwenhoekii |
| 16 | 5905375 | 5905635 | - | NZ_CP048882.1 | Streptomyces bathyalis |
| 17 | 2216157 | 2216408 | - | NZ_CP066060.1 | Actinomyces oris |
| 18 | 1101270 | 1101530 | + | NZ_CP026734.1 | Brevibacterium linens |
| 19 | 2112308 | 2112553 | + | NZ_CP018863.1 | Arthrobacter crystallopoietes |
| 20 | 1257706 | 1257966 | + | NC_016906.1 | Gordonia polyisoprenivorans VH2 |
| 21 | 2801122 | 2801373 | - | NZ_LR134406.1 | Arachnia propionica |
| 22 | 2244436 | 2244696 | - | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 23 | 2790010 | 2790258 | - | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 24 | 828321 | 828599 | + | NZ_CP035504.1 | Kocuria indica |
| 25 | 1168244 | 1168516 | + | NZ_CP035504.1 | Kocuria indica |
| 26 | 2316477 | 2316728 | + | NZ_CP034438.1 | Flaviflexus salsibiostraticola |
| 27 | 240014 | 240274 | - | NZ_CP040635.1 | Acidipropionibacterium jensenii |
| 28 | 170351 | 170620 | - | NZ_CP035810.1 | Brevibacterium luteolum |
| 29 | 1995982 | 1996233 | - | NZ_LR134477.1 | Actinomyces viscosus |
| 30 | 872297 | 872557 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 31 | 1560644 | 1560904 | - | NZ_CP023202.1 | Streptomyces xinghaiensis S187 |
| 32 | 1857887 | 1858126 | + | NZ_CP020468.1 | Actinomyces gaoshouyii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06769.16 | 1.0 | 30 | -3.0 | same-strand | YoeB-like toxin of bacterial type II toxin-antitoxin system |
++ More..