Result : P9WF21
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin VapB4 (VapB-mt4) |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 695228 |
| Right | 695485 |
| Strand | - |
| Nucleotide Sequence | ATGTCTGCTACGATACCCGCTCGCGATCTTCGCAACCACACCGCCGAGGTACTGCGGCGAGTTGCCGCCGGCGAGGAAATCGAGGTGCTCAAGGACAATCGCCCCGTAGCGCGCATCGTTCCGCTCAAGCGGCGCCGCCAATGGTTGCCAGCTGCCGAGGTGATCGGCGAACTGGTGCGCTTGGGCCCCGATACCACCAATCTGGGCGAGGAGCTGCGAGAGACGCTGACGCAAACCACGGACGATGTGCGGTGGTGA |
| Sequence | MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that counteracts the effect of its cognate VapC4 toxin. Upon expression in situ, in M.smegmatis or E.coli neutralizes the effect of cognate toxin VapC4. {ECO:0000269|Pubmed:19016878, ECO:0000269|Pubmed:22354968, ECO:0000269|Pubmed:25622615}. |
| Pubmed ID | 9634230 15718296 19016878 22354968 25622615 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WF21 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 695228 | 695485 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 710364 | 710621 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 1297089 | 1297346 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02470.22 | 0.67 | 2 | 2598.5 | opposite-strand | MlaD protein |
| 2 | PF01850.23 | 1.0 | 3 | -6 | same-strand | PIN domain |
| 3 | PF13635.8 | 0.67 | 2 | 183.0 | same-strand | Domain of unknown function (DUF4143) |
| 4 | PF13173.8 | 0.67 | 2 | 183.0 | same-strand | AAA domain |
| 5 | PF02518.28 | 0.67 | 2 | 2419.5 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
++ More..