Result : P9WF19
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative antitoxin VapB5 |
| NCBI Accession ID | AL123456.3 |
| Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
| Left | 718025 |
| Right | 718285 |
| Strand | + |
| Nucleotide Sequence | ATGTCTGAGGTGGCCTCGCGTGAGCTGCGTAACGATACGGCCGGCGTGCTGCGCCGCGTGCGGGCAGGGGAGGACGTCACCATCACCGTCAGCGGCCGTCCGGTCGCGGTGCTTACCCCGGTTCGTCCGCGGCGCCGGCGTTGGCTGAGCAAAACGGAGTTCCTGTCGCGGTTGCGCGGCGCTCAAGCCGATCCCGGGCTCCGTAACGACCTCGCGGTCCTTGCCGGCGACACGACCGAGGATCTCGGGCCGATCCGGTGA |
| Sequence | MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR |
| Source of smORF | Swiss-Prot |
| Function | Probable antitoxin component of a type II toxin-antitoxin (TA) system. The cognate toxin is VapC5. {ECO:0000269|Pubmed:18952600}. |
| Pubmed ID | 9634230 15718296 21969609 25622615 18952600 |
| Domain | CDD:415595 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | P9WF19 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 718025 | 718285 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1916726 | 1916986 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 3 | 2253510 | 2253770 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 4 | 3547166 | 3547426 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 5 | 4168901 | 4169161 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 6 | 912412 | 912672 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 7 | 1110761 | 1111021 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 8 | 1999502 | 1999762 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 9 | 4690774 | 4691031 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 10 | 5379207 | 5379464 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
| 11 | 2990028 | 2990285 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 12 | 1488043 | 1488303 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 13 | 2102395 | 2102655 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 14 | 5637601 | 5637858 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 15 | 2968566 | 2968826 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 16 | 3625468 | 3625725 | - | NZ_CP035494.1 | Microbacterium protaetiae |
| 17 | 3642317 | 3642565 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 18 | 1039516 | 1039728 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01850.23 | 0.83 | 15 | -3.0 | same-strand | PIN domain |
++ More..