Protein Information |
Information Type | Description |
---|---|
Protein name | Putative antitoxin VapB5 |
NCBI Accession ID | AL123456.3 |
Organism | Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) |
Left | 718025 |
Right | 718285 |
Strand | + |
Nucleotide Sequence | ATGTCTGAGGTGGCCTCGCGTGAGCTGCGTAACGATACGGCCGGCGTGCTGCGCCGCGTGCGGGCAGGGGAGGACGTCACCATCACCGTCAGCGGCCGTCCGGTCGCGGTGCTTACCCCGGTTCGTCCGCGGCGCCGGCGTTGGCTGAGCAAAACGGAGTTCCTGTCGCGGTTGCGCGGCGCTCAAGCCGATCCCGGGCTCCGTAACGACCTCGCGGTCCTTGCCGGCGACACGACCGAGGATCTCGGGCCGATCCGGTGA |
Sequence | MSEVASRELRNDTAGVLRRVRAGEDVTITVSGRPVAVLTPVRPRRRRWLSKTEFLSRLRGAQADPGLRNDLAVLAGDTTEDLGPIR |
Source of smORF | Swiss-Prot |
Function | Probable antitoxin component of a type II toxin-antitoxin (TA) system. The cognate toxin is VapC5. {ECO:0000269|Pubmed:18952600}. |
Pubmed ID | 9634230 15718296 21969609 25622615 18952600 |
Domain | CDD:415595 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | P9WF19 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 718025 | 718285 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
2 | 1916726 | 1916986 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
3 | 2253510 | 2253770 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
4 | 3547166 | 3547426 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
5 | 4168901 | 4169161 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
6 | 912412 | 912672 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
7 | 1110761 | 1111021 | - | NZ_AP022614.1 | Mycobacterium parmense |
8 | 1999502 | 1999762 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
9 | 4690774 | 4691031 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
10 | 5379207 | 5379464 | + | NZ_AP022601.1 | Mycobacterium gallinarum |
11 | 2990028 | 2990285 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
12 | 1488043 | 1488303 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
13 | 2102395 | 2102655 | + | NZ_AP022581.1 | Mycobacterium lacus |
14 | 5637601 | 5637858 | - | NZ_AP022560.1 | Mycolicibacterium moriokaense |
15 | 2968566 | 2968826 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
16 | 3625468 | 3625725 | - | NZ_CP035494.1 | Microbacterium protaetiae |
17 | 3642317 | 3642565 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
18 | 1039516 | 1039728 | - | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01850.23 | 0.83 | 15 | -3.0 | same-strand | PIN domain |