Result : A0L5U1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L28 |
| NCBI Accession ID | CP000471.1 |
| Organism | Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) |
| Left | 1018912 |
| Right | 1019199 |
| Strand | - |
| Nucleotide Sequence | GTGGCACGCAAAAGAACGCTGGGTGGAAAAGCCCCCCAGGCTGGTAACAAAGTATCCCACTCCCAACGCAAAACCCGTCGTCAGTGGATGCCTAATATTCAGACCAAAGCCCTTTGGAGCATCACCCTGGGCCAATCTGTCAAGGTCACCATCTCCACCAGCGCCCTGCGCTCTGTGGATAACGCCGGTGGGCTGGACAACTACCTGCTTAAAATTCTGCCCTCCGAACTGACCCCCTCCATGCGTCGCGTGGCCCGTCAGATCCGTGAGCGCAAAGCCGCTGCCTGA |
| Sequence | MARKRTLGGKAPQAGNKVSHSQRKTRRQWMPNIQTKALWSITLGQSVKVTISTSALRSVDNAGGLDNYLLKILPSELTPSMRRVARQIRERKAAA |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00367. Profile Description: Ribosomal L28 family. This model describes bacterial and chloroplast forms of the 50S ribosomal protein L28, a polypeptide about 60 amino acids in length. Mitochondrial homologs differ substantially in architecture (e.g. SP|P36525 from Saccharomyces cerevisiae, which is 258 amino acids long) and are not included. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
| Pubmed ID | 19465526 |
| Domain | CDD:412338 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A0L5U1 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1018912 | 1019199 | - | NC_008576.1 | Magnetococcus marinus MC-1 |
| 2 | 3347085 | 3347381 | - | NZ_AP014648.1 | Methyloceanibacter caenitepidi |
| 3 | 1101205 | 1101492 | + | NZ_CP053562.1 | Thioclava electrotropha |
| 4 | 3109242 | 3109535 | + | NZ_CP048630.1 | Ancylobacter pratisalsi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP014648.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00271.33 | 0.75 | 3 | 2866 | opposite-strand | Helicase conserved C-terminal domain |
++ More..