Result : P96739
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YwtC |
| NCBI Accession ID | Z92954.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 2709 |
| Right | 2876 |
| Strand | + |
| Nucleotide Sequence | ATGAAATTTGTCAAAGCCATCTGGCCGTTTGTTGCCGTAGCCATCGTGTTCATGTTTATGTCAGCTTTTAAATTCAATGATCAGCTGACAGATCAGGAAAAACAGAAGATTGATATGGAAATGAATAAAATCCAGCAGCAGGAAGAACCGGTAAACGCCAATAAATAA |
| Sequence | MKFVKAIWPFVAVAIVFMFMSAFKFNDQLTDQEKQKIDMEMNKIQQQEEPVNANK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9353933 11751809 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | P96739 |
| ORF Length (Amino Acid) | 55 |
++ More..
| Conservation Analysis |
No. of Species: 15
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3697639 | 3697806 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 3518412 | 3518579 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 3 | 3569412 | 3569579 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 3507616 | 3507783 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 3563258 | 3563425 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 6 | 3487331 | 3487498 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 7 | 2550997 | 2551164 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 8 | 490385 | 490546 | + | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 3554120 | 3554281 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 2088690 | 2088860 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 11 | 3267963 | 3268133 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 12 | 2030006 | 2030176 | + | NZ_CP043404.1 | Bacillus safensis |
| 13 | 4092188 | 4092355 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 3664734 | 3664901 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 15 | 3863536 | 3863703 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00083.26 | 1.0 | 15 | 3836 | same-strand | Sugar (and other) transporter |
| 2 | PF07690.18 | 1.0 | 15 | 3836 | same-strand | Major Facilitator Superfamily |
| 3 | PF03816.16 | 1.0 | 15 | 2598 | opposite-strand | LytR cpsA psr family |
| 4 | PF08282.14 | 1.0 | 15 | 1430 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 5 | PF00702.28 | 1.0 | 15 | 1430 | opposite-strand | haloacid dehalogenase-like hydrolase |
| 6 | PF00877.21 | 1.0 | 15 | 141 | same-strand | NlpC/P60 family |
| 7 | PF05708.14 | 0.6 | 9 | 157 | same-strand | Permuted papain-like amidase enzyme, YaeF/YiiX, C92 family |
| 8 | PF09587.12 | 1.0 | 15 | 8 | same-strand | Bacterial capsule synthesis protein PGA cap |
| 9 | PF14102.8 | 1.0 | 15 | 1176 | same-strand | Capsule biosynthesis CapC |
| 10 | PF13377.8 | 0.67 | 10 | 3612.0 | opposite-strand | Periplasmic binding protein-like domain |
| 11 | PF00532.23 | 0.67 | 10 | 3612.0 | opposite-strand | Periplasmic binding proteins and sugar binding domain of LacI family |
| 12 | PF00356.23 | 0.67 | 10 | 3612.0 | opposite-strand | Bacterial regulatory proteins, lacI family |
| 13 | PF13407.8 | 0.67 | 10 | 3612.0 | opposite-strand | Periplasmic binding protein domain |
| 14 | PF00294.26 | 0.67 | 10 | 4593.0 | opposite-strand | pfkB family carbohydrate kinase |
++ More..